Symbol:
Pdia3
Name:
protein disulfide isomerase family A, member 3
RGD ID:
68430
Description:
Enables MHC class I protein binding activity; peptidase activity; and protein-disulfide reductase (glutathione) activity. Involved in several processes, including cellular response to nonylphenol; response to benzene; and response to ischemia. Located in several cellular components, including acrosomal vesicle; apical plasma membrane; and smooth endoplasmic reticulum. Part of TAP complex. Used to study autoimmune hepatitis and irritable bowel syndrome. Biomarker of asphyxia neonatorum; irritable bowel syndrome; liver cirrhosis; post-traumatic stress disorder; and pulmonary hypertension. Human ortholog(s) of this gene implicated in autoimmune hepatitis. Orthologous to human PDIA3 (protein disulfide isomerase family A member 3); PARTICIPATES IN antigen processing and presentation pathway; Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
58 kDa glucose-regulated protein; 58 kDa microsomal protein; disulfide isomerase ER-60; endoplasmic reticulum resident protein 57; endoplasmic reticulum resident protein 60; ER protein 57; ER protein 60; ER-60 protease; ER60; ERp57; ERp60; glucose regulated protein, 58 kDa; Grp58; HIP-70; oxidoreductase ERp57; p58; protein disulfide isomerase associated 3; protein disulfide-isomerase A3; Q-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDIA3 (protein disulfide isomerase family A member 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pdia3 (protein disulfide isomerase associated 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdia3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDIA3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDIA3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdia3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDIA3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDIA3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdia3 (protein disulfide isomerase family A member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PCDHB4 (protocadherin beta 4) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Pdia3 (protein disulfide isomerase associated 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PDIA3 (protein disulfide isomerase family A member 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdia3 (protein disulfide isomerase family A, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
EUG1
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
ERp60
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pdi-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PDI1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pdia3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 128,841,781 - 128,865,733 (+) NCBI GRCr8 mRatBN7.2 3 108,388,189 - 108,412,013 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 108,388,245 - 108,413,236 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 112,062,478 - 112,086,451 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 120,657,999 - 120,681,970 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 118,318,399 - 118,342,371 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 113,376,983 - 113,400,707 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 113,376,983 - 113,400,707 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 119,916,772 - 119,940,826 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 108,216,414 - 108,240,138 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 108,117,203 - 108,140,928 (+) NCBI Celera 3 107,289,603 - 107,313,229 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdia3 Rat (-)-epigallocatechin 3-gallate increases expression ISO PDIA3 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PDIA3 protein CTD PMID:31195006 Pdia3 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of PDIA3 mRNA CTD PMID:21983209 Pdia3 Rat 1,3-dinitrobenzene increases metabolic processing EXP 6480464 3-dinitrobenzene results in increased metabolism of PDIA3 protein CTD PMID:21402099 Pdia3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PDIA3 mRNA CTD PMID:17108234 Pdia3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PDIA3 protein CTD PMID:32145629 Pdia3 Rat 17beta-estradiol decreases expression ISO Pdia3 (Mus musculus) 6480464 Estradiol results in decreased expression of PDIA3 mRNA CTD PMID:39298647 Pdia3 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO PDIA3 (Homo sapiens) 6480464 Metribolone results in increased expression of PDIA3 protein CTD PMID:17152098 Pdia3 Rat 17beta-hydroxy-5alpha-androstan-3-one affects expression EXP 6480464 Dihydrotestosterone affects the expression of PDIA3 protein CTD PMID:19639176 Pdia3 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PDIA3 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PDIA3 mRNA CTD PMID:29581250 Pdia3 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions EXP 6480464 [2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine co-treated with Dihydrotestosterone] affects the expression of PDIA3 protein CTD PMID:19639176 Pdia3 Rat 1H-pyrazole increases expression ISO Pdia3 (Mus musculus) 6480464 pyrazole results in increased expression of PDIA3 mRNA CTD PMID:17945193 Pdia3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pdia3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pdia3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDIA3 mRNA CTD PMID:16054898 Pdia3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDIA3 mRNA CTD PMID:34747641 Pdia3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pdia3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDIA3 mRNA CTD PMID:33956508 Pdia3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pdia3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PDIA3 mRNA CTD PMID:21570461 Pdia3 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Pdia3 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PDIA3 mRNA CTD PMID:17982090 Pdia3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Pdia3 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Pdia3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Pdia3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PDIA3 mRNA CTD PMID:21346803 Pdia3 Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of PDIA3 protein CTD PMID:15928459 and PMID:19033394 Pdia3 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of PDIA3 protein CTD PMID:15928459 Pdia3 Rat 2,6-dimethoxyphenol multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pdia3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PDIA3 mRNA CTD PMID:21346803 Pdia3 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PDIA3 mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of PDIA3 mRNA CTD PMID:14656948 and PMID:16158176 Pdia3 Rat 2-hydroxypropanoic acid increases expression ISO PDIA3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PDIA3 mRNA CTD PMID:30851411 Pdia3 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Pdia3 (Mus musculus) 6480464 [3 more ... CTD PMID:23457121 Pdia3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pdia3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PDIA3 mRNA CTD PMID:26251327 Pdia3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of PDIA3 protein and alpha-Chlorohydrin results in increased expression of PDIA3 protein CTD PMID:26072098 and PMID:26597043 Pdia3 Rat 4,4'-sulfonyldiphenol increases expression ISO Pdia3 (Mus musculus) 6480464 bisphenol S results in increased expression of PDIA3 mRNA CTD PMID:39298647 Pdia3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PDIA3 mRNA CTD PMID:36041667 Pdia3 Rat 4,4'-sulfonyldiphenol increases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol S results in increased expression of PDIA3 protein CTD PMID:34186270 Pdia3 Rat 4-hydroxynon-2-enal affects binding ISO PDIA3 (Homo sapiens) 6480464 4-hydroxy-2-nonenal analog binds to PDIA3 CTD PMID:18232660 Pdia3 Rat 4-hydroxyphenyl retinamide multiple interactions ISO PDIA3 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Fenretinide results in increased expression of PDIA3 mRNA] and Ascorbic Acid inhibits the reaction [Fenretinide results in increased expression of PDIA3 protein] CTD PMID:17353921 Pdia3 Rat 4-hydroxyphenyl retinamide increases expression ISO PDIA3 (Homo sapiens) 6480464 Fenretinide results in increased expression of PDIA3 mRNA and Fenretinide results in increased expression of PDIA3 protein CTD PMID:17353921 Pdia3 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Pdia3 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:22248470 Pdia3 Rat aldehydo-D-glucose decreases expression ISO Pdia3 (Mus musculus) 6480464 Glucose results in decreased expression of PDIA3 mRNA CTD PMID:17178593 Pdia3 Rat all-trans-retinoic acid increases expression ISO PDIA3 (Homo sapiens) 6480464 Tretinoin results in increased expression of PDIA3 mRNA CTD PMID:33167477 Pdia3 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PDIA3 mRNA CTD PMID:16483693 Pdia3 Rat aristolochic acid A decreases expression ISO PDIA3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PDIA3 mRNA CTD PMID:33212167 Pdia3 Rat aristolochic acid A increases expression ISO PDIA3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PDIA3 protein CTD PMID:33212167 Pdia3 Rat Aroclor 1254 decreases expression ISO Pdia3 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PDIA3 mRNA CTD PMID:23650126 Pdia3 Rat arsane increases expression ISO PDIA3 (Homo sapiens) 6480464 Arsenic results in increased expression of PDIA3 protein CTD PMID:19818359 Pdia3 Rat arsenic atom increases expression ISO PDIA3 (Homo sapiens) 6480464 Arsenic results in increased expression of PDIA3 protein CTD PMID:19818359 Pdia3 Rat arsenite(3-) increases oxidation ISO PDIA3 (Homo sapiens) 6480464 arsenite results in increased oxidation of PDIA3 protein CTD PMID:20196163 Pdia3 Rat arsenous acid decreases expression ISO PDIA3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PDIA3 protein CTD PMID:19364129 Pdia3 Rat Azaspiracid increases expression ISO PDIA3 (Homo sapiens) 6480464 azaspiracid results in increased expression of PDIA3 mRNA CTD PMID:28939011 Pdia3 Rat benzatropine decreases expression ISO PDIA3 (Homo sapiens) 6480464 Benztropine results in decreased expression of PDIA3 protein CTD PMID:34122009 Pdia3 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat benzo[a]pyrene decreases methylation ISO PDIA3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PDIA3 exon CTD PMID:27901495 Pdia3 Rat benzo[a]pyrene diol epoxide I increases expression ISO PDIA3 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Pdia3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pdia3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PDIA3 mRNA CTD PMID:33754040 Pdia3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDIA3 mRNA CTD PMID:25181051 Pdia3 Rat bisphenol A decreases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PDIA3 protein CTD PMID:34186270 Pdia3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PDIA3 mRNA CTD PMID:36041667 Pdia3 Rat bisphenol A increases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol A results in increased expression of PDIA3 protein CTD PMID:33376534 Pdia3 Rat bisphenol A decreases expression ISO Pdia3 (Mus musculus) 6480464 bisphenol A results in decreased expression of PDIA3 mRNA and bisphenol A results in decreased expression of PDIA3 protein CTD PMID:33221593 and PMID:35999755 Pdia3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDIA3 protein CTD PMID:32145629 Pdia3 Rat bisphenol A affects expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol A affects the expression of PDIA3 mRNA CTD PMID:30903817 Pdia3 Rat bisphenol A affects binding EXP 6480464 bisphenol A binds to PDIA3 protein CTD PMID:21976707 Pdia3 Rat bisphenol AF increases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PDIA3 protein CTD PMID:34186270 Pdia3 Rat Bisphenol B increases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol B results in increased expression of PDIA3 protein CTD PMID:34186270 Pdia3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PDIA3 mRNA CTD PMID:36041667 Pdia3 Rat bisphenol F increases expression ISO PDIA3 (Homo sapiens) 6480464 bisphenol F results in increased expression of PDIA3 protein CTD PMID:34186270 Pdia3 Rat bleomycin A2 multiple interactions EXP 6480464 [Bleomycin co-treated with Cisplatin co-treated with Etoposide] results in increased expression of PDIA3 protein CTD PMID:24478030 Pdia3 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PDIA3 protein CTD PMID:28903499 Pdia3 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to PDIA3 protein CTD PMID:12018992 Pdia3 Rat cadmium atom multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDIA3 protein CTD PMID:33040242 Pdia3 Rat cadmium dichloride multiple interactions ISO Pdia3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of PDIA3 mRNA CTD PMID:19840844 Pdia3 Rat cadmium dichloride increases expression ISO PDIA3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PDIA3 mRNA CTD PMID:38568856 Pdia3 Rat cadmium dichloride multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDIA3 protein CTD PMID:33040242 Pdia3 Rat cadmium dichloride decreases expression ISO PDIA3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PDIA3 protein CTD PMID:24419708 Pdia3 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PDIA3 mRNA CTD PMID:18636176 Pdia3 Rat caffeine affects phosphorylation ISO PDIA3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PDIA3 protein CTD PMID:35688186 Pdia3 Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of PDIA3 mRNA CTD PMID:17293106 Pdia3 Rat carbon nanotube increases expression ISO Pdia3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Pdia3 Rat choline multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PDIA3 protein CTD PMID:19566968 Pdia3 Rat cisplatin multiple interactions EXP 6480464 [Bleomycin co-treated with Cisplatin co-treated with Etoposide] results in increased expression of PDIA3 protein CTD PMID:24478030 Pdia3 Rat cisplatin affects response to substance ISO PDIA3 (Homo sapiens) 6480464 PDIA3 affects the susceptibility to Cisplatin CTD PMID:15756446 Pdia3 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of PDIA3 mRNA CTD PMID:17602206 Pdia3 Rat clozapine decreases expression ISO PDIA3 (Homo sapiens) 6480464 Clozapine results in decreased expression of PDIA3 protein CTD PMID:34122009 Pdia3 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PDIA3 mRNA CTD PMID:20187946 Pdia3 Rat cocaine multiple interactions ISO Pdia3 (Mus musculus) 6480464 Cocaine affects the reaction [PTN affects the expression of PDIA3 protein modified form] CTD PMID:24096156 Pdia3 Rat copper atom affects binding ISO PDIA3 (Homo sapiens) 6480464 PDIA3 protein binds to Copper CTD PMID:14534351 and PMID:15359738 Pdia3 Rat copper(0) affects binding ISO PDIA3 (Homo sapiens) 6480464 PDIA3 protein binds to Copper CTD PMID:14534351 and PMID:15359738 Pdia3 Rat copper(II) chloride decreases expression ISO Pdia3 (Mus musculus) 6480464 cupric chloride results in decreased expression of PDIA3 protein CTD PMID:29617964 Pdia3 Rat copper(II) sulfate decreases expression ISO PDIA3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PDIA3 mRNA CTD PMID:19549813 Pdia3 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of PDIA3 mRNA CTD PMID:18480146 Pdia3 Rat coumestrol multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PDIA3 mRNA CTD PMID:19167446 Pdia3 Rat CU-O LINKAGE decreases expression ISO PDIA3 (Homo sapiens) 6480464 cupric oxide results in decreased expression of PDIA3 protein CTD PMID:25470785 Pdia3 Rat curcumin increases expression ISO PDIA3 (Homo sapiens) 6480464 Curcumin results in increased expression of PDIA3 mRNA CTD PMID:29723631 Pdia3 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of PDIA3 mRNA CTD PMID:11906922 Pdia3 Rat cyclosporin A decreases expression ISO Pdia3 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PDIA3 protein CTD PMID:25047351 Pdia3 Rat cyclosporin A increases expression ISO PDIA3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PDIA3 mRNA CTD PMID:20106945 more ... Pdia3 Rat cyclosporin A increases expression ISO Pdia3 (Mus musculus) 6480464 Cyclosporine results in increased expression of PDIA3 mRNA CTD PMID:25047351 and PMID:25270620 Pdia3 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of PDIA3 protein CTD PMID:21561882 Pdia3 Rat D-glucose decreases expression ISO Pdia3 (Mus musculus) 6480464 Glucose results in decreased expression of PDIA3 mRNA CTD PMID:17178593 Pdia3 Rat dextran sulfate decreases expression ISO Pdia3 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PDIA3 protein CTD PMID:35999755 Pdia3 Rat diarsenic trioxide decreases expression ISO PDIA3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PDIA3 protein CTD PMID:19364129 Pdia3 Rat Dibutyl phosphate affects expression ISO PDIA3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PDIA3 mRNA CTD PMID:37042841 Pdia3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PDIA3 mRNA CTD PMID:21266533 Pdia3 Rat dibutyl phthalate decreases expression ISO Pdia3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PDIA3 mRNA CTD PMID:17361019 and PMID:21266533 Pdia3 Rat diethylstilbestrol affects metabolic processing EXP 6480464 Diethylstilbestrol affects the metabolism of PDIA3 protein CTD PMID:20932895 Pdia3 Rat dopamine decreases expression ISO PDIA3 (Homo sapiens) 6480464 Dopamine results in decreased expression of PDIA3 protein CTD PMID:24675778 Pdia3 Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of PDIA3 protein CTD PMID:28818578 Pdia3 Rat doxorubicin affects localization ISO PDIA3 (Homo sapiens) 6480464 Doxorubicin affects the localization of PDIA3 protein CTD PMID:39097071 Pdia3 Rat doxorubicin affects localization ISO Pdia3 (Mus musculus) 6480464 Doxorubicin affects the localization of PDIA3 protein CTD PMID:39097071 Pdia3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PDIA3 mRNA and Endosulfan results in increased expression of PDIA3 protein CTD PMID:29391264 and PMID:31464424 Pdia3 Rat Enterolactone multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PDIA3 mRNA CTD PMID:19167446 Pdia3 Rat enzyme inhibitor multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PDIA3 protein CTD PMID:23301498 Pdia3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PDIA3 protein CTD PMID:24646710 Pdia3 Rat ethanol affects expression ISO Pdia3 (Mus musculus) 6480464 Ethanol affects the expression of PDIA3 mRNA CTD PMID:30319688 Pdia3 Rat ethanol multiple interactions ISO Pdia3 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PDIA3 mRNA CTD PMID:30319688 Pdia3 Rat etoposide multiple interactions EXP 6480464 [Bleomycin co-treated with Cisplatin co-treated with Etoposide] results in increased expression of PDIA3 protein CTD PMID:24478030 Pdia3 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PDIA3 mRNA CTD PMID:18035473 Pdia3 Rat folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PDIA3 protein CTD PMID:19566968 Pdia3 Rat furan affects binding EXP 6480464 furan binds to PDIA3 protein CTD PMID:22240984 Pdia3 Rat furfural multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Pdia3 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PDIA3 protein CTD PMID:22649256 Pdia3 Rat glucose decreases expression ISO Pdia3 (Mus musculus) 6480464 Glucose results in decreased expression of PDIA3 mRNA CTD PMID:17178593 Pdia3 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of PDIA3 protein CTD PMID:23178681 Pdia3 Rat hydrogen peroxide increases expression ISO PDIA3 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PDIA3 protein CTD PMID:18603805 Pdia3 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PDIA3 protein CTD PMID:23178681 Pdia3 Rat iodide salt decreases expression EXP 6480464 Iodides deficiency results in decreased expression of PDIA3 protein CTD PMID:26795019 Pdia3 Rat isoflavones multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Pdia3 Rat ivermectin decreases expression ISO PDIA3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PDIA3 protein CTD PMID:32959892 Pdia3 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of PDIA3 mRNA CTD PMID:18544905 Pdia3 Rat L-ascorbic acid multiple interactions ISO PDIA3 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Fenretinide results in increased expression of PDIA3 mRNA] and Ascorbic Acid inhibits the reaction [Fenretinide results in increased expression of PDIA3 protein] CTD PMID:17353921 Pdia3 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat L-methionine multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of PDIA3 protein CTD PMID:19566968 Pdia3 Rat lead diacetate increases expression ISO Pdia3 (Mus musculus) 6480464 lead acetate results in increased expression of PDIA3 protein CTD PMID:20797405 Pdia3 Rat lead(II) chloride decreases expression ISO PDIA3 (Homo sapiens) 6480464 lead chloride results in decreased expression of PDIA3 protein CTD PMID:24419708 Pdia3 Rat limonene increases expression EXP 6480464 limonene results in increased expression of PDIA3 mRNA CTD PMID:12815608 Pdia3 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of PDIA3 protein CTD PMID:18296634 Pdia3 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of PDIA3 protein CTD PMID:18296634 Pdia3 Rat lovastatin decreases expression ISO Pdia3 (Mus musculus) 6480464 Lovastatin results in decreased expression of PDIA3 mRNA CTD PMID:20493250 Pdia3 Rat lovastatin increases expression ISO Pdia3 (Mus musculus) 6480464 Lovastatin results in increased expression of PDIA3 mRNA CTD PMID:20493250 Pdia3 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PDIA3 protein CTD PMID:19826936 Pdia3 Rat microcystin RR increases expression ISO PDIA3 (Homo sapiens) 6480464 microcystin RR results in increased expression of PDIA3 protein CTD PMID:19111056 Pdia3 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of PDIA3 protein CTD PMID:22430071 Pdia3 Rat Monobutylphthalate increases expression ISO Pdia3 (Mus musculus) 6480464 monobutyl phthalate results in increased expression of PDIA3 protein CTD PMID:20553848 Pdia3 Rat N-hydroxy-PhIP affects expression EXP 6480464 2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine affects the expression of PDIA3 protein CTD PMID:19639176 Pdia3 Rat N-hydroxy-PhIP multiple interactions EXP 6480464 [2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine co-treated with Dihydrotestosterone] affects the expression of PDIA3 protein CTD PMID:19639176 Pdia3 Rat N-methyl-4-phenylpyridinium increases expression ISO PDIA3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PDIA3 protein CTD PMID:24675778 Pdia3 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Pdia3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of PDIA3 mRNA more ... CTD PMID:19840844 Pdia3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of PDIA3 mRNA more ... CTD PMID:14656948 more ... Pdia3 Rat N-nitrosodiethylamine multiple interactions ISO Pdia3 (Mus musculus) 6480464 [3 more ... CTD PMID:23457121 Pdia3 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of PDIA3 protein CTD PMID:19716841 Pdia3 Rat naphthalene affects binding ISO Pdia3 (Mus musculus) 6480464 naphthalene metabolite binds to PDIA3 protein CTD PMID:15892573 and PMID:16206326 Pdia3 Rat Nonylphenol affects expression EXP 6480464 nonylphenol affects the expression of PDIA3 protein CTD PMID:19429228 Pdia3 Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of PDIA3 protein CTD PMID:19260726 Pdia3 Rat ochratoxin A increases expression ISO PDIA3 (Homo sapiens) 6480464 ochratoxin A results in increased expression of PDIA3 protein CTD PMID:26861962 Pdia3 Rat okadaic acid multiple interactions ISO Pdia3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of PDIA3 mRNA CTD PMID:19840844 Pdia3 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of PDIA3 mRNA CTD PMID:12486162 Pdia3 Rat ozone multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PDIA3 mRNA CTD PMID:35430440 Pdia3 Rat paracetamol affects expression ISO Pdia3 (Mus musculus) 6480464 Acetaminophen affects the expression of PDIA3 mRNA CTD PMID:17562736 Pdia3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PDIA3 mRNA CTD PMID:33387578 Pdia3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PDIA3 protein CTD PMID:16538041 Pdia3 Rat paraquat increases expression ISO Pdia3 (Mus musculus) 6480464 Paraquat results in increased expression of PDIA3 mRNA CTD PMID:21371552 Pdia3 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PDIA3 mRNA CTD PMID:19162173 Pdia3 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PDIA3 mRNA CTD PMID:19162173 Pdia3 Rat perfluorooctanoic acid decreases expression ISO PDIA3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PDIA3 protein CTD PMID:22609092 Pdia3 Rat phenobarbital affects expression ISO PDIA3 (Homo sapiens) 6480464 Phenobarbital affects the expression of PDIA3 mRNA CTD PMID:19159669 Pdia3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Pdia3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in increased expression of PDIA3 mRNA CTD PMID:19840844 Pdia3 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PDIA3 mRNA CTD PMID:19162173 Pdia3 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of PDIA3 mRNA CTD PMID:15686871 Pdia3 Rat progesterone affects expression ISO Pdia3 (Mus musculus) 6480464 Progesterone affects the expression of PDIA3 mRNA CTD PMID:17251523 Pdia3 Rat Propiverine affects binding EXP 6480464 propiverine binds to PDIA3 protein CTD PMID:29273565 Pdia3 Rat pyrogallol increases expression ISO Pdia3 (Mus musculus) 6480464 Pyrogallol results in increased expression of PDIA3 mRNA CTD PMID:20362636 Pdia3 Rat quercetin decreases expression ISO PDIA3 (Homo sapiens) 6480464 Quercetin results in decreased expression of PDIA3 mRNA CTD PMID:21632981 Pdia3 Rat rac-lactic acid increases expression ISO PDIA3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PDIA3 mRNA CTD PMID:30851411 Pdia3 Rat resveratrol affects secretion ISO PDIA3 (Homo sapiens) 6480464 resveratrol affects the secretion of PDIA3 protein CTD PMID:24802182 Pdia3 Rat resveratrol affects expression ISO PDIA3 (Homo sapiens) 6480464 resveratrol affects the expression of PDIA3 protein CTD PMID:23255428 Pdia3 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of PDIA3 protein CTD PMID:30951809 Pdia3 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression EXP 6480464 Buthionine Sulfoximine results in increased expression of PDIA3 protein CTD PMID:23736079 Pdia3 Rat sarin affects expression EXP 6480464 Sarin affects the expression of PDIA3 protein CTD PMID:28973502 Pdia3 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PDIA3 protein CTD PMID:29459688 Pdia3 Rat sodium arsenite increases expression ISO Pdia3 (Mus musculus) 6480464 sodium arsenite results in increased expression of PDIA3 mRNA CTD PMID:37682722 Pdia3 Rat sodium arsenite multiple interactions ISO PDIA3 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [PDIA3 protein binds to CAPRIN1 protein] CTD PMID:33939924 Pdia3 Rat sodium arsenite decreases expression ISO PDIA3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PDIA3 mRNA CTD PMID:28595984 and PMID:34032870 Pdia3 Rat sodium arsenite decreases expression ISO Pdia3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PDIA3 mRNA CTD PMID:19822182 Pdia3 Rat sodium arsenite increases expression ISO PDIA3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PDIA3 protein CTD PMID:21925251 Pdia3 Rat sodium arsenite affects expression ISO PDIA3 (Homo sapiens) 6480464 sodium arsenite affects the expression of PDIA3 protein CTD PMID:21925251 Pdia3 Rat sodium chloride multiple interactions ISO PDIA3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PDIA3 protein more ... CTD PMID:38598786 Pdia3 Rat sodium fluoride decreases expression ISO Pdia3 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PDIA3 protein CTD PMID:27548804 Pdia3 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PDIA3 protein CTD PMID:26141394 Pdia3 Rat Tartrolon D affects localization ISO PDIA3 (Homo sapiens) 6480464 tartrolon D affects the localization of PDIA3 protein CTD PMID:39097071 Pdia3 Rat Tartrolon D affects localization ISO Pdia3 (Mus musculus) 6480464 tartrolon D affects the localization of PDIA3 protein CTD PMID:39097071 Pdia3 Rat testosterone affects expression ISO Pdia3 (Mus musculus) 6480464 Testosterone affects the expression of PDIA3 mRNA CTD PMID:17003280 Pdia3 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PDIA3 protein CTD PMID:16845489 Pdia3 Rat tetrachloromethane increases expression ISO Pdia3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PDIA3 mRNA CTD PMID:31919559 Pdia3 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PDIA3 protein CTD PMID:16613267 Pdia3 Rat tetrachloromethane multiple interactions EXP 6480464 Drugs and Chinese Herbal inhibits the reaction [Carbon Tetrachloride affects the expression of PDIA3 protein] CTD PMID:16613267 Pdia3 Rat thapsigargin increases expression ISO PDIA3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of PDIA3 mRNA and Thapsigargin results in increased expression of PDIA3 protein CTD PMID:17353921 Pdia3 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PDIA3 protein CTD PMID:35544339 Pdia3 Rat thimerosal decreases expression ISO PDIA3 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PDIA3 mRNA CTD PMID:27188386 Pdia3 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PDIA3 mRNA CTD PMID:19483382 Pdia3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PDIA3 mRNA CTD PMID:34492290 Pdia3 Rat titanium dioxide increases expression ISO Pdia3 (Mus musculus) 6480464 titanium dioxide results in increased expression of PDIA3 mRNA CTD PMID:23557971 and PMID:27760801 Pdia3 Rat titanium dioxide decreases methylation ISO Pdia3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PDIA3 gene CTD PMID:35295148 Pdia3 Rat trichloroethene decreases expression ISO Pdia3 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of PDIA3 mRNA CTD PMID:19448997 Pdia3 Rat troglitazone increases expression ISO Pdia3 (Mus musculus) 6480464 troglitazone results in increased expression of PDIA3 mRNA CTD PMID:28973697 Pdia3 Rat tunicamycin increases expression ISO Pdia3 (Mus musculus) 6480464 Tunicamycin results in increased expression of PDIA3 mRNA CTD PMID:17127020 Pdia3 Rat tunicamycin increases expression ISO PDIA3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of PDIA3 mRNA CTD PMID:29723631 Pdia3 Rat valproic acid increases expression ISO PDIA3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PDIA3 mRNA CTD PMID:23179753 Pdia3 Rat valproic acid decreases methylation ISO PDIA3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PDIA3 gene CTD PMID:29154799 Pdia3 Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of PDIA3 mRNA CTD PMID:25423262 Pdia3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PDIA3 protein CTD PMID:20616205 Pdia3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PDIA3 mRNA CTD PMID:15686871 and PMID:23034163 Pdia3 Rat vorinostat decreases expression ISO PDIA3 (Homo sapiens) 6480464 vorinostat results in decreased expression of PDIA3 mRNA CTD PMID:27188386 Pdia3 Rat warfarin increases expression ISO Pdia3 (Mus musculus) 6480464 Warfarin results in increased expression of PDIA3 mRNA CTD PMID:20493250 Pdia3 Rat warfarin decreases expression ISO Pdia3 (Mus musculus) 6480464 Warfarin results in decreased expression of PDIA3 mRNA CTD PMID:20493250 Pdia3 Rat zinc atom affects binding ISO PDIA3 (Homo sapiens) 6480464 PDIA3 protein binds to Zinc CTD PMID:14534351 Pdia3 Rat zinc oxide increases expression ISO Pdia3 (Mus musculus) 6480464 Zinc Oxide analog results in increased expression of PDIA3 mRNA CTD PMID:25680694 Pdia3 Rat zinc(0) affects binding ISO PDIA3 (Homo sapiens) 6480464 PDIA3 protein binds to Zinc CTD PMID:14534351
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azaspiracid (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bleomycin A2 (EXP) Brodifacoum (EXP) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcidiol (EXP) carbon nanotube (ISO) choline (EXP) cisplatin (EXP,ISO) clofibrate (EXP) clofibric acid (EXP) clozapine (ISO) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (EXP) coumestrol (ISO) CU-O LINKAGE (ISO) curcumin (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) cypermethrin (EXP) D-glucose (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (EXP) dopamine (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) etoposide (EXP) flavonoids (EXP) folic acid (EXP) furan (EXP) furfural (ISO) genistein (EXP) glucose (ISO) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) iodide salt (EXP) isoflavones (EXP) ivermectin (ISO) kojic acid (EXP) L-ascorbic acid (ISO) L-ethionine (EXP) L-methionine (EXP) lead diacetate (ISO) lead(II) chloride (ISO) limonene (EXP) lithium atom (EXP) lithium hydride (EXP) lovastatin (ISO) methamphetamine (EXP) microcystin RR (ISO) microcystin-LR (EXP) Monobutylphthalate (ISO) N-hydroxy-PhIP (EXP) N-methyl-4-phenylpyridinium (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosomorpholine (EXP) naphthalene (ISO) Nonylphenol (EXP) ochratoxin A (ISO) okadaic acid (ISO) omeprazole (EXP) oxidopamine (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP) procymidone (EXP) progesterone (ISO) Propiverine (EXP) pyrogallol (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) sarin (EXP) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) T-2 toxin (EXP) Tartrolon D (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP) vorinostat (ISO) warfarin (ISO) zinc atom (ISO) zinc oxide (ISO) zinc(0) (ISO)
Cellular Component
acrosomal vesicle (IDA) apical plasma membrane (IDA) cell surface (IBA,IDA,IEA,ISO) endoplasmic reticulum (IBA,IEA,ISO,ISS) endoplasmic reticulum lumen (IEA) extracellular region (IDA) extracellular space (IDA,IEA,ISO) melanosome (IEA) MHC class I peptide loading complex (IDA,IEA,ISO) smooth endoplasmic reticulum (IDA) TAP complex (IDA) Tapasin-ERp57 complex (IEA,ISO)
1.
The oxidoreductase ERp57 efficiently reduces partially folded in preference to fully folded MHC class I molecules.
Antoniou AN, etal., EMBO J. 2002 Jun 3;21(11):2655-63.
2.
A proteomic analysis of liver after ethanol binge in chronically ethanol treated rats.
Aroor AR, etal., Proteome Sci. 2012 Apr 30;10(1):29. doi: 10.1186/1477-5956-10-29.
3.
Molecular cloning and complete amino-acid sequence of form-I phosphoinositide-specific phospholipase C.
Bennett CF, etal., Nature 1988 Jul 21;334(6179):268-70.
4.
PDIA3 mRNA expression and IL-2, IL-4, IL-6, and CRP levels of acute kidney allograft rejection in rat.
Chen G, etal., Mol Biol Rep. 2012 May;39(5):5233-8. doi: 10.1007/s11033-011-1321-1. Epub 2011 Dec 27.
5.
[Proteomic expression analysis of colonic mucosa in a rat model of irritable bowel syndrome].
Ding Y, etal., Zhonghua Yi Xue Za Zhi. 2010 Mar 2;90(8):564-9.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Dehydration-induced proteome changes in the rat hypothalamo-neurohypophyseal system.
Gouraud SS, etal., Endocrinology. 2007 Jul;148(7):3041-52. Epub 2007 Apr 5.
8.
The disulfide isomerase Grp58 is a protective factor against prion neurotoxicity.
Hetz C, etal., J Neurosci. 2005 Mar 16;25(11):2793-802.
9.
An interaction map of endoplasmic reticulum chaperones and foldases.
Jansen G, etal., Mol Cell Proteomics. 2012 Sep;11(9):710-23. doi: 10.1074/mcp.M111.016550. Epub 2012 Jun 4.
10.
Evidence for phosphorylation of rat liver glucose-regulated protein 58, GRP58/ERp57/ER-60, induced by fasting and leptin.
Kita K, etal., FEBS Lett. 2006 Jan 9;580(1):199-205. Epub 2005 Dec 9.
11.
Life-long effects of perinatal asphyxia on stress-induced proteins and dynamin 1 in rat brain.
Kitzmueller E, etal., Neurochem Res. 2004 Sep;29(9):1767-77.
12.
Identification of seven proteins in the endoplasmic reticulum as targets for reactive metabolites of bromobenzene.
Koen YM and Hanzlik RP, Chem Res Toxicol. 2002 May;15(5):699-706.
13.
LKM-1 sera from autoimmune hepatitis patients that recognize ERp57, carboxylesterase 1 and CYP2D6.
Komurasaki R, etal., Drug Metab Pharmacokinet. 2010;25(1):84-92.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
A role for the thiol-dependent reductase ERp57 in the assembly of MHC class I molecules.
Morrice NA and Powis SJ, Curr Biol. 1998 Jun 4;8(12):713-6.
16.
Proteomic analysis of the lung in rats with hypobaric hypoxia-induced pulmonary hypertension.
Ohata Y, etal., Histol Histopathol. 2013 Jul;28(7):893-902. Epub 2013 Jan 10.
17.
ERp57-associated mitochondrial micro-calpain truncates apoptosis-inducing factor.
Ozaki T, etal., Biochim Biophys Acta. 2008 Oct;1783(10):1955-63. doi: 10.1016/j.bbamcr.2008.05.011. Epub 2008 May 24.
18.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Identification and characterization of 1,25D3-membrane-associated rapid response, steroid (1,25D3-MARRS)-binding protein in rat IEC-6 cells.
Rohe B, etal., Steroids. 2005 May-Jun;70(5-7):458-63. Epub 2005 Apr 1.
23.
Molecular architecture of the TAP-associated MHC class I peptide-loading complex.
Rufer E, etal., J Immunol. 2007 Nov 1;179(9):5717-27.
24.
Proteomic analysis of rat heart in ischemia and ischemia-reperfusion using fluorescence two-dimensional difference gel electrophoresis.
Sakai J, etal., Proteomics. 2003 Jul;3(7):1318-24.
25.
Differential cooperative enzymatic activities of protein disulfide isomerase family in protein folding.
Satoh M, etal., Cell Stress Chaperones. 2005 Autumn;10(3):211-20.
26.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
27.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
28.
Inhibition by acidic phospholipids of protein degradation by ER-60 protease, a novel cysteine protease, of endoplasmic reticulum.
Urade R and Kito M, FEBS Lett. 1992 Nov 2;312(1):83-6.
29.
Proteomic discovery of genistein action in the rat mammary gland.
Wang J, etal., J Proteome Res. 2011 Apr 1;10(4):1621-31. Epub 2011 Feb 22.
30.
Proteomic analysis of changes induced by nonylphenol in Sprague-Dawley rat Sertoli cells.
Wu J, etal., Chem Res Toxicol. 2009 Apr;22(4):668-75. doi: 10.1021/tx800406z.
31.
Interaction with grp58 increases activity of the thiazide-sensitive Na-Cl cotransporter.
Wyse B, etal., Am J Physiol Renal Physiol 2002 Mar;282(3):F424-30.
32.
Knockdown of ERp57 increases BiP/GRP78 induction and protects against hyperoxia and tunicamycin-induced apoptosis.
Xu D, etal., Am J Physiol Lung Cell Mol Physiol. 2009 Jul;297(1):L44-51. doi: 10.1152/ajplung.90626.2008. Epub 2009 May 1.
33.
Single Prolonged Stress induces ATF6 alpha-dependent Endoplasmic reticulum stress and the apoptotic process in medial Frontal Cortex neurons.
Yu B, etal., BMC Neurosci. 2014 Oct 21;15:115. doi: 10.1186/s12868-014-0115-5.
34.
Proteome analysis of hepatic non-parenchymal cells of immune liver fibrosis rats.
Zhao Q, etal., Sci China Life Sci. 2014 Mar;57(3):303-14. doi: 10.1007/s11427-014-4619-0. Epub 2014 Feb 21.
35.
Distribution of PDIA3 transcript and protein in rat testis and sperm cells.
Zhao XJ, etal., Reprod Domest Anim. 2013 Feb;48(1):59-63. doi: 10.1111/j.1439-0531.2012.02024.x. Epub 2012 Apr 2.
36.
The effect of PDIA3 gene knockout on the mucosal immune function in IBS rats.
Zhuang ZM, etal., Int J Clin Exp Med. 2015 May 15;8(5):6866-77. eCollection 2015.
Pdia3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 128,841,781 - 128,865,733 (+) NCBI GRCr8 mRatBN7.2 3 108,388,189 - 108,412,013 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 108,388,245 - 108,413,236 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 112,062,478 - 112,086,451 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 120,657,999 - 120,681,970 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 118,318,399 - 118,342,371 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 113,376,983 - 113,400,707 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 113,376,983 - 113,400,707 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 119,916,772 - 119,940,826 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 108,216,414 - 108,240,138 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 108,117,203 - 108,140,928 (+) NCBI Celera 3 107,289,603 - 107,313,229 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
PDIA3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 43,746,438 - 43,773,278 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 43,746,394 - 43,773,279 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 44,038,636 - 44,065,476 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 41,825,882 - 41,852,096 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 15 20,928,053 - 20,954,266 (+) NCBI Celera Cytogenetic Map 15 q15.3 NCBI HuRef 15 20,861,356 - 20,887,666 (+) NCBI HuRef CHM1_1 15 44,156,851 - 44,183,060 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 41,553,795 - 41,580,638 (+) NCBI T2T-CHM13v2.0
Pdia3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 121,244,383 - 121,269,168 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 121,244,256 - 121,269,168 (+) Ensembl GRCm39 Ensembl GRCm38 2 121,413,902 - 121,438,687 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 121,413,775 - 121,438,687 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 121,239,638 - 121,264,423 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 121,105,401 - 121,129,421 (+) NCBI MGSCv36 mm8 Celera 2 122,564,601 - 122,589,381 (+) NCBI Celera Cytogenetic Map 2 E5 NCBI cM Map 2 60.38 NCBI
Pdia3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 10,198,099 - 10,220,792 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 10,197,957 - 10,221,104 (+) NCBI ChiLan1.0 ChiLan1.0
PDIA3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 32,997,271 - 33,023,322 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 37,158,999 - 37,185,059 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 22,706,520 - 22,731,672 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 40,794,144 - 40,821,615 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 40,794,144 - 40,821,763 (+) Ensembl panpan1.1 panPan2
PDIA3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 10,487,926 - 10,513,437 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 10,487,921 - 10,513,397 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 10,546,317 - 10,571,800 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 10,624,436 - 10,649,938 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 10,624,468 - 10,651,817 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 10,533,603 - 10,559,083 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 10,655,339 - 10,680,999 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 10,775,223 - 10,800,728 (+) NCBI UU_Cfam_GSD_1.0
Pdia3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 88,961,177 - 88,986,202 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 6,809,195 - 6,836,169 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 6,809,181 - 6,834,189 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDIA3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 127,785,772 - 127,814,196 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 127,786,174 - 127,814,096 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 142,615,686 - 142,643,747 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PDIA3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 39,273,982 - 39,300,170 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 39,272,997 - 39,349,966 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 101,691,336 - 101,717,748 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdia3
.
Predicted Target Of
Count of predictions: 404 Count of miRNA genes: 229 Interacting mature miRNAs: 270 Transcripts: ENSRNOT00000020478 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1582216 Bw65 Body weight QTL 65 6.3 body mass (VT:0001259) body weight (CMO:0000012) 3 102200529 115665732 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH131986
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 108,412,652 - 108,412,850 (+) MAPPER mRatBN7.2 Rnor_6.0 3 113,401,350 - 113,401,547 NCBI Rnor6.0 Rnor_5.0 3 119,941,469 - 119,941,666 UniSTS Rnor5.0 RGSC_v3.4 3 108,240,781 - 108,240,978 UniSTS RGSC3.4 Celera 3 107,313,872 - 107,314,069 UniSTS RH 3.4 Map 3 953.6 UniSTS Cytogenetic Map 3 q35 UniSTS
BE107553
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 108,407,474 - 108,407,641 (+) MAPPER mRatBN7.2 Rnor_6.0 3 113,396,172 - 113,396,338 NCBI Rnor6.0 Rnor_5.0 3 119,936,291 - 119,936,457 UniSTS Rnor5.0 RGSC_v3.4 3 108,235,603 - 108,235,769 UniSTS RGSC3.4 Celera 3 107,308,692 - 107,308,858 UniSTS RH 3.4 Map 3 954.5 UniSTS Cytogenetic Map 3 q35 UniSTS
RH138056
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 108,390,715 - 108,390,871 (+) MAPPER mRatBN7.2 mRatBN7.2 4 56,924,637 - 56,924,731 (+) MAPPER mRatBN7.2 Rnor_6.0 3 113,379,415 - 113,379,570 NCBI Rnor6.0 Rnor_5.0 3 119,919,204 - 119,919,648 UniSTS Rnor5.0 Rnor_5.0 3 119,919,204 - 119,919,359 UniSTS Rnor5.0 RGSC_v3.4 3 108,218,846 - 108,219,001 UniSTS RGSC3.4 Celera 3 107,292,035 - 107,292,190 UniSTS RH 3.4 Map 3 947.6 UniSTS Cytogenetic Map 3 q35 UniSTS
Grp58
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 128,865,601 - 128,865,727 (+) Marker Load Pipeline mRatBN7.2 3 108,411,882 - 108,412,007 (+) MAPPER mRatBN7.2 Rnor_6.0 3 113,400,580 - 113,400,704 NCBI Rnor6.0 Rnor_5.0 3 119,940,699 - 119,940,823 UniSTS Rnor5.0 RGSC_v3.4 3 108,240,011 - 108,240,135 UniSTS RGSC3.4 Celera 3 107,313,102 - 107,313,226 UniSTS Cytogenetic Map 3 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020478 ⟹ ENSRNOP00000020478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 108,388,249 - 108,411,982 (+) Ensembl Rnor_6.0 Ensembl 3 113,376,983 - 113,400,707 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113825 ⟹ ENSRNOP00000083210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 108,388,245 - 108,413,236 (+) Ensembl
RefSeq Acc Id:
NM_017319 ⟹ NP_059015
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 128,841,914 - 128,865,733 (+) NCBI mRatBN7.2 3 108,388,189 - 108,412,013 (+) NCBI Rnor_6.0 3 113,376,983 - 113,400,707 (+) NCBI Rnor_5.0 3 119,916,772 - 119,940,826 (+) NCBI RGSC_v3.4 3 108,216,414 - 108,240,138 (+) RGD Celera 3 107,289,603 - 107,313,229 (+) RGD
Sequence:
GGCACGAGGCGGGCTCTCCCATCTCGGTTCTCTGGTCCCGGCCCTCCGATTGCCCCCGCCGCATCCCGCCGCCATGCGCTTCAGCTGCCTTGCGCTGCTCCCGGGCGTGGCGTTGCTGCTCGCCTCGG
hide sequence
RefSeq Acc Id:
XM_063283216 ⟹ XP_063139286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 128,841,781 - 128,865,731 (+) NCBI
RefSeq Acc Id:
NP_059015 ⟸ NM_017319
- Peptide Label:
precursor
- UniProtKB:
P11598 (UniProtKB/Swiss-Prot), A0A8I6GAH4 (UniProtKB/TrEMBL), A6HPP1 (UniProtKB/TrEMBL)
- Sequence:
MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHL
hide sequence
Ensembl Acc Id:
ENSRNOP00000020478 ⟸ ENSRNOT00000020478
Ensembl Acc Id:
ENSRNOP00000083210 ⟸ ENSRNOT00000113825
RefSeq Acc Id:
XP_063139286 ⟸ XM_063283216
- Peptide Label:
isoform X1
- UniProtKB:
P11598 (UniProtKB/Swiss-Prot)
RGD ID: 13692356 Promoter ID: EPDNEW_R2881 Type: multiple initiation site Name: Pdia3_1 Description: protein disulfide isomerase family A, member 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 113,376,951 - 113,377,011 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-10
Pdia3
protein disulfide isomerase family A, member 3
Pdia3
protein disulfide isomerase associated 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Pdia3
protein disulfide isomerase associated 3
Symbol and Name updated
1299863 APPROVED
2002-06-10
Grp58
glucose regulated protein, 58 kDa
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_process
increases activity of the thiazide-sensitive Na-Cl cotransporter
632898
