Symbol:
Erc1
Name:
ELKS/RAB6-interacting/CAST family member 1
RGD ID:
628733
Description:
Enables PDZ domain binding activity. Predicted to be involved in several processes, including I-kappaB phosphorylation; maintenance of presynaptic active zone structure; and positive regulation of NF-kappaB transcription factor activity. Located in membrane; postsynaptic density; and synaptic vesicle. Is active in presynaptic active zone cytoplasmic component. Orthologous to human ERC1 (ELKS/RAB6-interacting/CAST family member 1); PARTICIPATES IN interleukin-1 signaling pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CAST; Cast2; CAZ-associated structural protein 2; Elks; ERC; ERC protein 1; ERC-1; ERC1b; Rab6 interacting protein 2; Rab6-interacting protein 2; Rab6ip2; RIM-Binding Protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 154,435,936 - 154,727,987 (-) NCBI GRCr8 mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 152,767,419 - 153,055,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 159,025,966 - 159,332,211 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 154,809,683 - 155,115,934 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 153,433,030 - 153,739,286 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 152,087,393 - 152,380,023 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 152,087,379 - 152,380,184 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 219,174,705 - 219,465,108 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 155,931,377 - 156,221,104 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 156,234,169 - 156,465,945 (-) NCBI Celera 4 141,623,820 - 141,910,539 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Erc1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ERC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ERC1 mRNA CTD PMID:22079256 Erc1 Rat (1->4)-beta-D-glucan multiple interactions ISO Erc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ERC1 mRNA CTD PMID:36331819 Erc1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ERC1 mRNA CTD PMID:32145629 Erc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ERC1 mRNA CTD PMID:22298810 Erc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ERC1 mRNA CTD PMID:33387578 and PMID:34747641 Erc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Erc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ERC1 mRNA CTD PMID:21570461 Erc1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Erc1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of ERC1 mRNA CTD PMID:22952946 Erc1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Erc1 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Erc1 Rat 4,4'-sulfonyldiphenol increases expression ISO ERC1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ERC1 protein CTD PMID:34186270 Erc1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Erc1 (Mus musculus) 6480464 Fenretinide results in decreased expression of ERC1 mRNA CTD PMID:28973697 Erc1 Rat 5-aza-2'-deoxycytidine affects expression ISO ERC1 (Homo sapiens) 6480464 Decitabine affects the expression of ERC1 mRNA CTD PMID:23300844 Erc1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ERC1 mRNA CTD PMID:31881176 Erc1 Rat acrolein multiple interactions ISO ERC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ERC1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ERC1 mRNA CTD PMID:32699268 Erc1 Rat aflatoxin B1 decreases expression ISO ERC1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ERC1 mRNA CTD PMID:21641981 Erc1 Rat aflatoxin B1 increases methylation ISO ERC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ERC1 gene CTD PMID:27153756 Erc1 Rat Aflatoxin B2 alpha decreases methylation ISO ERC1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of ERC1 intron CTD PMID:30157460 Erc1 Rat alpha-pinene multiple interactions ISO ERC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ERC1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ERC1 mRNA CTD PMID:32699268 Erc1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ERC1 mRNA CTD PMID:16483693 Erc1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ERC1 mRNA CTD PMID:30779732 Erc1 Rat aristolochic acid A decreases expression ISO ERC1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ERC1 mRNA CTD PMID:33212167 Erc1 Rat arsane multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat arsenic atom multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat arsenite(3-) multiple interactions ISO ERC1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ERC1 mRNA] CTD PMID:32406909 Erc1 Rat arsenous acid decreases expression ISO ERC1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ERC1 mRNA CTD PMID:20458559 Erc1 Rat benzo[a]pyrene decreases expression ISO ERC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ERC1 mRNA CTD PMID:20064835 more ... Erc1 Rat benzo[a]pyrene increases methylation ISO ERC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ERC1 5' UTR CTD PMID:27901495 Erc1 Rat benzo[a]pyrene affects methylation ISO ERC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ERC1 intron CTD PMID:30157460 Erc1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ERC1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 more ... Erc1 Rat benzo[e]pyrene decreases methylation ISO ERC1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of ERC1 intron CTD PMID:30157460 Erc1 Rat beta-lapachone increases expression ISO ERC1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ERC1 mRNA CTD PMID:38218311 Erc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ERC1 mRNA CTD PMID:25181051 and PMID:30816183 Erc1 Rat bisphenol A decreases expression ISO Erc1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ERC1 mRNA CTD PMID:37894381 Erc1 Rat bisphenol A increases expression ISO Erc1 (Mus musculus) 6480464 bisphenol A results in increased expression of ERC1 mRNA CTD PMID:38074096 Erc1 Rat bisphenol A multiple interactions ISO ERC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ERC1 gene CTD PMID:31601247 Erc1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ERC1 mRNA CTD PMID:32145629 Erc1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ERC1 gene CTD PMID:28505145 Erc1 Rat bisphenol AF increases expression ISO ERC1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ERC1 protein CTD PMID:34186270 Erc1 Rat Bisphenol B increases expression ISO ERC1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ERC1 protein CTD PMID:34186270 Erc1 Rat bisphenol F increases expression ISO Erc1 (Mus musculus) 6480464 bisphenol F results in increased expression of ERC1 mRNA CTD PMID:38685157 Erc1 Rat bisphenol F multiple interactions ISO ERC1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of ERC1 gene CTD PMID:31601247 Erc1 Rat cadmium dichloride increases expression ISO ERC1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ERC1 mRNA CTD PMID:26472689 and PMID:38382870 Erc1 Rat caffeine decreases phosphorylation ISO ERC1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ERC1 protein CTD PMID:35688186 Erc1 Rat CGP 52608 multiple interactions ISO ERC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ERC1 gene] CTD PMID:28238834 Erc1 Rat chlorpyrifos decreases expression ISO Erc1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ERC1 mRNA CTD PMID:37019170 Erc1 Rat cisplatin affects expression ISO ERC1 (Homo sapiens) 6480464 Cisplatin affects the expression of ERC1 mRNA CTD PMID:23300844 Erc1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of ERC1 mRNA CTD PMID:12851107 Erc1 Rat diarsenic trioxide decreases expression ISO ERC1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ERC1 mRNA CTD PMID:20458559 Erc1 Rat Dibutyl phosphate affects expression ISO ERC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ERC1 mRNA CTD PMID:37042841 Erc1 Rat dicrotophos increases expression ISO ERC1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ERC1 mRNA CTD PMID:28302478 Erc1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ERC1 mRNA CTD PMID:29391264 Erc1 Rat entinostat increases expression ISO ERC1 (Homo sapiens) 6480464 entinostat results in increased expression of ERC1 mRNA CTD PMID:27188386 Erc1 Rat epoxiconazole decreases expression ISO Erc1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ERC1 mRNA CTD PMID:35436446 Erc1 Rat ethanol affects splicing ISO Erc1 (Mus musculus) 6480464 Ethanol affects the splicing of ERC1 mRNA CTD PMID:30319688 Erc1 Rat folic acid decreases expression ISO Erc1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ERC1 mRNA CTD PMID:25629700 Erc1 Rat FR900359 increases phosphorylation ISO ERC1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ERC1 protein CTD PMID:37730182 Erc1 Rat fulvestrant multiple interactions ISO ERC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ERC1 gene and [bisphenol F co-treated with Fulvestrant] results in increased methylation of ERC1 gene CTD PMID:31601247 Erc1 Rat genistein decreases expression ISO Erc1 (Mus musculus) 6480464 Genistein results in decreased expression of ERC1 mRNA CTD PMID:32186404 Erc1 Rat geraniol increases expression ISO ERC1 (Homo sapiens) 6480464 geraniol results in increased expression of ERC1 mRNA CTD PMID:27683099 Erc1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of ERC1 mRNA CTD PMID:24915197 and PMID:37926403 Erc1 Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO ERC1 (Homo sapiens) 6480464 Arbutin results in increased expression of ERC1 mRNA CTD PMID:17103032 Erc1 Rat irinotecan decreases expression ISO ERC1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of ERC1 mRNA CTD PMID:18927307 Erc1 Rat ivermectin decreases expression ISO ERC1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ERC1 protein CTD PMID:32959892 Erc1 Rat ketoconazole decreases expression ISO ERC1 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of ERC1 mRNA CTD PMID:36621641 Erc1 Rat manganese atom multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat manganese(0) multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat manganese(II) chloride multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat methapyrilene decreases methylation ISO ERC1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of ERC1 intron CTD PMID:30157460 Erc1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ERC1 gene CTD PMID:35440735 Erc1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ERC1 gene CTD PMID:33148267 Erc1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ERC1 mRNA CTD PMID:20360939 Erc1 Rat nickel atom decreases expression ISO ERC1 (Homo sapiens) 6480464 Nickel results in decreased expression of ERC1 mRNA CTD PMID:25583101 Erc1 Rat ozone multiple interactions ISO ERC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ERC1 mRNA more ... CTD PMID:32699268 Erc1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ERC1 mRNA CTD PMID:33387578 Erc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Erc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ERC1 mRNA CTD PMID:36331819 Erc1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ERC1 gene CTD PMID:33148267 Erc1 Rat pinostrobin increases expression ISO ERC1 (Homo sapiens) 6480464 pinostrobin results in increased expression of ERC1 mRNA CTD PMID:37777166 Erc1 Rat pirinixic acid increases expression ISO Erc1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ERC1 mRNA CTD PMID:18301758 Erc1 Rat potassium chromate decreases expression ISO ERC1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ERC1 mRNA CTD PMID:22079256 Erc1 Rat potassium chromate multiple interactions ISO ERC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ERC1 mRNA CTD PMID:22079256 Erc1 Rat sodium arsenite increases expression ISO ERC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ERC1 mRNA CTD PMID:38568856 Erc1 Rat sodium arsenite multiple interactions ISO ERC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ERC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ERC1 mRNA CTD PMID:39836092 Erc1 Rat sunitinib decreases expression ISO ERC1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ERC1 mRNA CTD PMID:31533062 Erc1 Rat testosterone enanthate affects expression ISO ERC1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of ERC1 mRNA CTD PMID:17440010 Erc1 Rat thimerosal decreases expression ISO ERC1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of ERC1 mRNA CTD PMID:27188386 Erc1 Rat thiram increases expression ISO ERC1 (Homo sapiens) 6480464 Thiram results in increased expression of ERC1 mRNA CTD PMID:38568856 Erc1 Rat titanium dioxide decreases methylation ISO Erc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ERC1 gene CTD PMID:35295148 Erc1 Rat torcetrapib increases expression ISO ERC1 (Homo sapiens) 6480464 torcetrapib results in increased expression of ERC1 mRNA CTD PMID:23228038 Erc1 Rat triphenyl phosphate affects expression ISO ERC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ERC1 mRNA CTD PMID:37042841 Erc1 Rat triptonide affects expression ISO Erc1 (Mus musculus) 6480464 triptonide affects the expression of ERC1 mRNA CTD PMID:33045310 Erc1 Rat valproic acid affects expression ISO Erc1 (Mus musculus) 6480464 Valproic Acid affects the expression of ERC1 mRNA CTD PMID:17292431 Erc1 Rat valproic acid increases expression ISO Erc1 (Mus musculus) 6480464 Valproic Acid results in increased expression of ERC1 mRNA CTD PMID:21427059 Erc1 Rat valproic acid affects expression ISO ERC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ERC1 mRNA CTD PMID:25979313 Erc1 Rat valproic acid increases expression ISO ERC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ERC1 mRNA CTD PMID:19101580 more ...
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,5-hexanedione (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) geraniol (ISO) glycidol (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) irinotecan (ISO) ivermectin (ISO) ketoconazole (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) ozone (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) pinostrobin (ISO) pirinixic acid (ISO) potassium chromate (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone enanthate (ISO) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Cellular Component
anchoring junction (IEA) cell projection (IEA) centrosome (IEA,ISO) ciliary basal body (IEA,ISO) cytoplasm (IEA,ISO,ISS) cytoskeleton (IEA) endomembrane system (IEA) GABA-ergic synapse (ISO) glutamatergic synapse (ISO) Golgi apparatus (IEA) Golgi membrane (IEA) IkappaB kinase complex (IEA,ISO) membrane (IDA,IEA) podosome (IEA,ISO,ISS) postsynaptic density (IDA) presynapse (IEA) presynaptic active zone (IEA) presynaptic active zone cytoplasmic component (IBA,IDA) presynaptic cytosol (ISO) synapse (IEA,ISO,ISS) synaptic vesicle (IDA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
RIM proteins tether Ca2+ channels to presynaptic active zones via a direct PDZ-domain interaction.
Kaeser PS, etal., Cell. 2011 Jan 21;144(2):282-95. doi: 10.1016/j.cell.2010.12.029.
3.
Solution structure of the RIM1alpha PDZ domain in complex with an ELKS1b C-terminal peptide.
Lu J, etal., J Mol Biol. 2005 Sep 16;352(2):455-66.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
SAD-B Phosphorylation of CAST Controls Active Zone Vesicle Recycling for Synaptic Depression.
Mochida S, etal., Cell Rep. 2016 Sep 13;16(11):2901-2913. doi: 10.1016/j.celrep.2016.08.020.
6.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
A family of RIM-binding proteins regulated by alternative splicing: Implications for the genesis of synaptic active zones.
Wang Y, etal., Proc Natl Acad Sci U S A 2002 Oct 29;99(22):14464-9.
Erc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 154,435,936 - 154,727,987 (-) NCBI GRCr8 mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 152,767,419 - 153,055,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 159,025,966 - 159,332,211 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 154,809,683 - 155,115,934 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 153,433,030 - 153,739,286 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 152,087,393 - 152,380,023 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 152,087,379 - 152,380,184 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 219,174,705 - 219,465,108 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 155,931,377 - 156,221,104 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 156,234,169 - 156,465,945 (-) NCBI Celera 4 141,623,820 - 141,910,539 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
ERC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 989,959 - 1,495,933 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 990,509 - 1,495,933 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 1,100,389 - 1,605,099 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 970,665 - 1,472,958 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 2,707,077 - 3,211,656 (+) NCBI Celera Cytogenetic Map 12 p13.33 NCBI HuRef 12 952,225 - 1,457,980 (+) NCBI HuRef CHM1_1 12 1,099,408 - 1,604,090 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 985,850 - 1,490,194 (+) NCBI T2T-CHM13v2.0
Erc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 119,547,757 - 119,830,985 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 119,547,757 - 119,825,128 (-) Ensembl GRCm39 Ensembl GRCm38 6 119,570,796 - 119,848,184 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 119,570,796 - 119,848,167 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 119,520,814 - 119,798,168 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 119,540,864 - 119,813,753 (-) NCBI MGSCv36 mm8 Celera 6 121,405,104 - 121,685,429 (-) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 56.86 NCBI
Erc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 3,586,667 - 4,031,130 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 3,584,910 - 4,036,276 (+) NCBI ChiLan1.0 ChiLan1.0
ERC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 6,489,987 - 7,025,406 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 6,486,819 - 7,022,165 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 1,066,034 - 1,597,562 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 1,027,967 - 1,550,182 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 1,027,967 - 1,545,431 (+) Ensembl panpan1.1 panPan2
ERC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 43,004,243 - 43,544,260 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 43,038,544 - 43,678,843 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 3,140,420 - 3,679,170 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 43,365,560 - 43,911,683 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 43,365,538 - 43,911,649 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 43,303,937 - 43,842,830 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 43,275,814 - 43,815,242 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 2,498,548 - 3,038,339 (-) NCBI UU_Cfam_GSD_1.0
Erc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 107,470,207 - 107,982,754 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936606 1,201,657 - 1,708,551 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936606 1,201,420 - 1,713,894 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ERC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 68,223,729 - 68,608,703 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 68,223,722 - 68,608,705 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 70,490,274 - 70,873,482 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ERC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 989,376 - 1,530,470 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 1,030,294 - 1,524,817 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 6,812,077 - 7,356,786 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Erc1
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 58 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000012397 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
D4Rat107
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 154,597,593 - 154,597,827 (+) Marker Load Pipeline mRatBN7.2 4 152,925,326 - 152,925,562 (+) MAPPER mRatBN7.2 Rnor_6.0 4 152,249,616 - 152,249,849 NCBI Rnor6.0 Rnor_5.0 4 219,336,960 - 219,337,193 UniSTS Rnor5.0 RGSC_v3.4 4 156,090,003 - 156,090,237 RGD RGSC3.4 RGSC_v3.4 4 156,090,004 - 156,090,237 UniSTS RGSC3.4 RGSC_v3.1 4 156,334,845 - 156,335,078 RGD Celera 4 141,780,453 - 141,780,686 UniSTS RH 3.4 Map 4 978.8 UniSTS RH 3.4 Map 4 978.8 RGD RH 2.0 Map 4 972.5 RGD SHRSP x BN Map 4 77.0299 RGD Cytogenetic Map 4 q42 UniSTS
BE108954
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 154,677,093 - 154,677,273 (+) Marker Load Pipeline mRatBN7.2 4 153,004,831 - 153,005,011 (+) MAPPER mRatBN7.2 Rnor_6.0 4 152,329,598 - 152,329,777 NCBI Rnor6.0 Rnor_5.0 4 219,416,860 - 219,417,039 UniSTS Rnor5.0 RGSC_v3.4 4 156,170,532 - 156,170,711 UniSTS RGSC3.4 Celera 4 141,859,984 - 141,860,163 UniSTS RH 3.4 Map 4 978.9 UniSTS Cytogenetic Map 4 q42 UniSTS
BE095665
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 152,868,812 - 152,868,967 (+) MAPPER mRatBN7.2 Rnor_6.0 4 152,193,101 - 152,193,255 NCBI Rnor6.0 Rnor_5.0 4 219,280,713 - 219,280,867 UniSTS Rnor5.0 RGSC_v3.4 4 156,032,819 - 156,032,973 UniSTS RGSC3.4 Celera 4 141,724,043 - 141,724,197 UniSTS RH 3.4 Map 4 978.7 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012397 ⟹ ENSRNOP00000012397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 152,768,451 - 153,055,533 (-) Ensembl Rnor_6.0 Ensembl 4 152,092,180 - 152,380,023 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091473 ⟹ ENSRNOP00000070778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 152,767,419 - 153,055,533 (-) Ensembl Rnor_6.0 Ensembl 4 152,087,379 - 152,380,184 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102886 ⟹ ENSRNOP00000092904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 152,814,772 - 153,055,639 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109038 ⟹ ENSRNOP00000094050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 152,767,419 - 153,055,533 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115061 ⟹ ENSRNOP00000084657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 152,767,419 - 153,055,533 (-) Ensembl
RefSeq Acc Id:
NM_001394882 ⟹ NP_001381811
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,987 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI
RefSeq Acc Id:
NM_001394883 ⟹ NP_001381812
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,987 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI
RefSeq Acc Id:
NM_001394884 ⟹ NP_001381813
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,987 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI
RefSeq Acc Id:
NR_172210
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,987 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,724 (-) NCBI
RefSeq Acc Id:
XM_006237230 ⟹ XP_006237292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,851 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,704 (-) NCBI Rnor_6.0 4 152,087,393 - 152,380,021 (-) NCBI Rnor_5.0 4 219,174,705 - 219,465,108 (-) NCBI
Sequence:
CATTTGTCGTTTCCGACCGGGCTCTGCGCTCCCGGCCCTGGCTGGGCAGGGCAGAGTGCCCCTGGGGAGGGGCGGAGCCGTAGATATGGCATAAGATATTTCTTCAAGATTGGACAGCTGGTGACCTG
hide sequence
RefSeq Acc Id:
XM_039107148 ⟹ XP_038963076
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,851 (-) NCBI mRatBN7.2 4 152,763,664 - 153,055,704 (-) NCBI
RefSeq Acc Id:
XM_063285644 ⟹ XP_063141714
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,435,936 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XM_063285645 ⟹ XP_063141715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,460,510 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XM_063285646 ⟹ XP_063141716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,460,510 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XM_063285647 ⟹ XP_063141717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,460,510 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XM_063285648 ⟹ XP_063141718
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,460,510 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XM_063285649 ⟹ XP_063141719
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 154,460,510 - 154,727,851 (-) NCBI
RefSeq Acc Id:
XP_006237292 ⟸ XM_006237230
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AIL7 (UniProtKB/TrEMBL)
- Sequence:
MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGNSVGGGSGKTLSMENIQSLNAAYATSGPMYLSDHENVGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEH
hide sequence
Ensembl Acc Id:
ENSRNOP00000012397 ⟸ ENSRNOT00000012397
Ensembl Acc Id:
ENSRNOP00000070778 ⟸ ENSRNOT00000091473
RefSeq Acc Id:
XP_038963076 ⟸ XM_039107148
- Peptide Label:
isoform X1
- UniProtKB:
F1LPE9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092904 ⟸ ENSRNOT00000102886
Ensembl Acc Id:
ENSRNOP00000094050 ⟸ ENSRNOT00000109038
Ensembl Acc Id:
ENSRNOP00000084657 ⟸ ENSRNOT00000115061
RefSeq Acc Id:
NP_001381813 ⟸ NM_001394884
- Peptide Label:
isoform 3
- UniProtKB:
A0A8I6A0L5 (UniProtKB/TrEMBL), A6IL87 (UniProtKB/TrEMBL), F1LPE9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001381812 ⟸ NM_001394883
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2JYT1 (UniProtKB/TrEMBL), F1LPE9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001381811 ⟸ NM_001394882
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6GKZ4 (UniProtKB/TrEMBL), F1LPE9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141714 ⟸ XM_063285644
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AIL7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141719 ⟸ XM_063285649
- Peptide Label:
isoform X8
- UniProtKB:
A6IL88 (UniProtKB/TrEMBL), A0A8I6AIL7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141717 ⟸ XM_063285647
- Peptide Label:
isoform X6
- UniProtKB:
F1LPE9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141718 ⟸ XM_063285648
- Peptide Label:
isoform X7
- UniProtKB:
A6IL89 (UniProtKB/TrEMBL), A0A8I6AIL7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141716 ⟸ XM_063285646
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6AIL7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141715 ⟸ XM_063285645
- Peptide Label:
isoform X4
- UniProtKB:
F1LPE9 (UniProtKB/TrEMBL)
RGD ID: 13693353 Promoter ID: EPDNEW_R3875 Type: multiple initiation site Name: Erc1_1 Description: ELKS/RAB6-interacting/CAST family member 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 152,380,207 - 152,380,267 EPDNEW
BioCyc Gene G2FUF-43216 BioCyc
Ensembl Genes ENSRNOG00000009264 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000012397 ENTREZGENE
ENSRNOT00000091473 ENTREZGENE
ENSRNOT00000102886 ENTREZGENE
ENSRNOT00000109038 ENTREZGENE
ENSRNOT00000115061 ENTREZGENE
Gene3D-CATH 1.10.287.1490 UniProtKB/Swiss-Prot
InterPro ELKS/CAST UniProtKB/Swiss-Prot
NCBI Gene 266806 ENTREZGENE
PANTHER ELKS/RAB6-INTERACTING/CAST FAMILY MEMBER 1 UniProtKB/Swiss-Prot
ELKS/RAB6-INTERACTING/CAST PROTEIN UniProtKB/Swiss-Prot
Pfam Cast UniProtKB/Swiss-Prot
PhenoGen Erc1 PhenoGen
RatGTEx ENSRNOG00000009264 RatGTEx
Superfamily-SCOP Tropomyosin UniProtKB/Swiss-Prot
UniProt A0A0G2JYT1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A0L5 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AIL7 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GKZ4 ENTREZGENE, UniProtKB/TrEMBL
A6IL87 ENTREZGENE, UniProtKB/TrEMBL
A6IL88 ENTREZGENE, UniProtKB/TrEMBL
A6IL89 ENTREZGENE, UniProtKB/TrEMBL
F1LPE9 ENTREZGENE, UniProtKB/TrEMBL
Q811U3 ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary Q8CIY9 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-25
Erc1
ELKS/RAB6-interacting/CAST family member 1
Rab6ip2
Rab6 interacting protein 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Rab6ip2
Rab6 interacting protein 2
Elks
ELKS protein
Symbol and Name updated
1299863 APPROVED
2003-02-27
Elks
ELKS protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_transcript
has two alternative splicing variants; one variant generates a longer transcript that does not bind to RIMs
632516
