Symbol:
Macrod1
Name:
mono-ADP ribosylhydrolase 1
RGD ID:
628701
Description:
Predicted to enable ADP-ribosylglutamate hydrolase activity and deacetylase activity. Predicted to be involved in DNA damage response; peptidyl-glutamate ADP-deribosylation; and purine nucleoside metabolic process. Predicted to be located in mitochondrion and nucleus. Predicted to be active in nucleoplasm. Orthologous to human MACROD1 (mono-ADP ribosylhydrolase 1); PARTICIPATES IN ADP-ribosylation pathway, mono and poly-ribosylation; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
[Protein ADP-ribosylaspartate] hydrolase MACROD1; [Protein ADP-ribosylglutamate] hydrolase; [Protein ADP-ribosylglutamate] hydrolase MACROD1; ADP-ribose glycohydrolase MACROD1; Lrp16; MACRO domain containing 1; MACRO domain-containing protein 1; O-acetyl-ADP-ribose deacetylase; O-acetyl-ADP-ribose deacetylase MACROD1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,675,413 - 213,831,571 (+) NCBI GRCr8 mRatBN7.2 1 204,246,238 - 204,387,027 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,246,166 - 204,389,716 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,596,116 - 212,736,945 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,691,528 - 219,832,257 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,382,579 - 212,523,308 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,310,916 - 222,451,485 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,310,920 - 222,451,484 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,301,706 - 229,442,053 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,730,907 - 209,871,392 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,889,336 - 210,029,821 (+) NCBI Celera 1 201,779,880 - 201,919,740 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Macrod1 Rat 1,1-dichloroethene decreases expression ISO Macrod1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of MACROD1 mRNA CTD PMID:26682919 Macrod1 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Macrod1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Macrod1 Rat 1,2-dimethylhydrazine decreases expression ISO Macrod1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MACROD1 mRNA CTD PMID:22206623 Macrod1 Rat 17beta-estradiol decreases expression ISO Macrod1 (Mus musculus) 6480464 Estradiol results in decreased expression of MACROD1 mRNA CTD PMID:39298647 Macrod1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Macrod1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Macrod1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Macrod1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MACROD1 mRNA CTD PMID:21215274 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MACROD1 mRNA CTD PMID:33387578 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Macrod1 (Mus musculus) 6480464 MACROD1 protein inhibits the reaction [[TIPARP protein results in increased ADP-ribosylation of and results in decreased activity of AHR protein] which results in decreased susceptibility to Tetrachlorodibenzodioxin] CTD PMID:25975270 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MACROD1 (Homo sapiens) 6480464 MACROD1 protein inhibits the reaction [[TIPARP protein results in increased ADP-ribosylation of and results in decreased activity of AHR protein] which results in decreased susceptibility to Tetrachlorodibenzodioxin] and MACROD1 protein inhibits the reaction [TIPARP protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of CYP1A1 mRNA]] CTD PMID:25975270 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Macrod1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MACROD1 mRNA CTD PMID:21570461 Macrod1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MACROD1 mRNA CTD PMID:22298810 Macrod1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Macrod1 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Macrod1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Macrod1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MACROD1 mRNA CTD PMID:21346803 Macrod1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of MACROD1 mRNA CTD PMID:22382377 Macrod1 Rat 2,5-hexanedione multiple interactions EXP 6480464 [carbendazim co-treated with 2 and 5-hexanedione] results in decreased expression of MACROD1 mRNA CTD PMID:22382377 Macrod1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of MACROD1 protein CTD PMID:34915118 Macrod1 Rat 4-hydroxyphenyl retinamide increases expression ISO Macrod1 (Mus musculus) 6480464 Fenretinide results in increased expression of MACROD1 mRNA CTD PMID:28973697 Macrod1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MACROD1 mRNA CTD PMID:24780913 Macrod1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MACROD1 mRNA CTD PMID:31881176 Macrod1 Rat acrylamide decreases expression ISO MACROD1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of MACROD1 mRNA CTD PMID:32763439 Macrod1 Rat aflatoxin B1 affects expression ISO MACROD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MACROD1 protein CTD PMID:20106945 Macrod1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of MACROD1 mRNA CTD PMID:33354967 Macrod1 Rat aflatoxin B1 affects methylation ISO MACROD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of MACROD1 intron CTD PMID:30157460 Macrod1 Rat aflatoxin B1 decreases expression ISO MACROD1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MACROD1 mRNA CTD PMID:27153756 Macrod1 Rat aflatoxin B1 decreases expression ISO Macrod1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of MACROD1 mRNA CTD PMID:19770486 Macrod1 Rat Aflatoxin B2 alpha affects methylation ISO MACROD1 (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of MACROD1 intron CTD PMID:30157460 Macrod1 Rat all-trans-retinoic acid decreases expression ISO MACROD1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MACROD1 mRNA CTD PMID:23724009 and PMID:33167477 Macrod1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MACROD1 mRNA CTD PMID:35163327 Macrod1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MACROD1 mRNA CTD PMID:16483693 Macrod1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MACROD1 mRNA CTD PMID:30779732 Macrod1 Rat aristolochic acid A decreases expression ISO MACROD1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MACROD1 mRNA CTD PMID:33212167 Macrod1 Rat arsane multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat arsenic atom multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat benzo[a]pyrene decreases expression ISO MACROD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MACROD1 mRNA CTD PMID:20106945 more ... Macrod1 Rat benzo[a]pyrene affects methylation ISO MACROD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MACROD1 intron CTD PMID:30157460 Macrod1 Rat benzo[a]pyrene decreases expression ISO Macrod1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MACROD1 mRNA CTD PMID:19770486 and PMID:22610609 Macrod1 Rat benzo[a]pyrene diol epoxide I affects expression ISO MACROD1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Macrod1 Rat benzo[a]pyrene diol epoxide I increases expression ISO MACROD1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Macrod1 Rat benzo[e]pyrene affects methylation ISO MACROD1 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of MACROD1 intron CTD PMID:30157460 Macrod1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Macrod1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MACROD1 mRNA CTD PMID:33754040 Macrod1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MACROD1 mRNA CTD PMID:25181051 Macrod1 Rat bisphenol A increases expression ISO Macrod1 (Mus musculus) 6480464 bisphenol A results in increased expression of MACROD1 mRNA CTD PMID:32156529 Macrod1 Rat bisphenol A increases expression ISO MACROD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of MACROD1 protein CTD PMID:37567409 Macrod1 Rat bisphenol A decreases methylation ISO MACROD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MACROD1 gene CTD PMID:31601247 Macrod1 Rat bisphenol A decreases expression ISO Macrod1 (Mus musculus) 6480464 bisphenol A results in decreased expression of MACROD1 mRNA CTD PMID:35598803 Macrod1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MACROD1 gene CTD PMID:28505145 Macrod1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MACROD1 mRNA CTD PMID:21297351 Macrod1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of MACROD1 mRNA CTD PMID:25993096 Macrod1 Rat cantharidin decreases expression ISO Macrod1 (Mus musculus) 6480464 Cantharidin results in decreased expression of MACROD1 mRNA CTD PMID:36907384 Macrod1 Rat carbamazepine affects expression ISO MACROD1 (Homo sapiens) 6480464 Carbamazepine affects the expression of MACROD1 mRNA CTD PMID:25979313 Macrod1 Rat carbendazim multiple interactions EXP 6480464 [carbendazim co-treated with 2 and 5-hexanedione] results in decreased expression of MACROD1 mRNA CTD PMID:22382377 Macrod1 Rat carbon nanotube decreases expression ISO Macrod1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Macrod1 Rat chlorpyrifos increases expression ISO Macrod1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MACROD1 mRNA CTD PMID:37019170 Macrod1 Rat cisplatin decreases expression ISO MACROD1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MACROD1 mRNA CTD PMID:27594783 Macrod1 Rat cisplatin multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MACROD1 mRNA CTD PMID:27392435 Macrod1 Rat cisplatin decreases expression ISO Macrod1 (Mus musculus) 6480464 Cisplatin results in decreased expression of MACROD1 mRNA CTD PMID:25270620 Macrod1 Rat clobetasol increases expression ISO Macrod1 (Mus musculus) 6480464 Clobetasol results in increased expression of MACROD1 mRNA CTD PMID:27462272 Macrod1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MACROD1 mRNA CTD PMID:26577399 Macrod1 Rat cyclosporin A increases expression ISO MACROD1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MACROD1 mRNA CTD PMID:22147139 and PMID:27989131 Macrod1 Rat dieldrin affects methylation ISO Macrod1 (Mus musculus) 6480464 Dieldrin affects the methylation of MACROD1 gene CTD PMID:38995845 Macrod1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MACROD1 mRNA CTD PMID:25152437 Macrod1 Rat dorsomorphin multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MACROD1 mRNA CTD PMID:27188386 Macrod1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MACROD1 mRNA CTD PMID:29391264 Macrod1 Rat enzyme inhibitor multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MACROD1 protein CTD PMID:23301498 Macrod1 Rat fenthion increases expression ISO Macrod1 (Mus musculus) 6480464 Fenthion results in increased expression of MACROD1 mRNA CTD PMID:34813904 Macrod1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of MACROD1 mRNA CTD PMID:23962444 Macrod1 Rat genistein decreases expression ISO Macrod1 (Mus musculus) 6480464 Genistein results in decreased expression of MACROD1 mRNA CTD PMID:21048042 Macrod1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MACROD1 mRNA CTD PMID:22061828 Macrod1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of MACROD1 mRNA CTD PMID:24136188 Macrod1 Rat glyphosate increases expression ISO Macrod1 (Mus musculus) 6480464 Glyphosate results in increased expression of MACROD1 protein CTD PMID:36173347 Macrod1 Rat ivermectin decreases expression ISO MACROD1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MACROD1 protein CTD PMID:32959892 Macrod1 Rat manganese atom multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat manganese(0) multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat manganese(II) chloride multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat methapyrilene affects methylation ISO MACROD1 (Homo sapiens) 6480464 Methapyrilene affects the methylation of MACROD1 intron CTD PMID:30157460 Macrod1 Rat mitoxantrone affects response to substance ISO MACROD1 (Homo sapiens) 6480464 MACROD1 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Macrod1 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MACROD1 mRNA CTD PMID:28801915 Macrod1 Rat N-nitrosodiethylamine decreases expression ISO Macrod1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of MACROD1 mRNA CTD PMID:24535843 Macrod1 Rat N-nitrosodiethylamine multiple interactions ISO Macrod1 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of MACROD1 gene CTD PMID:23968726 Macrod1 Rat N-Nitrosopyrrolidine decreases expression ISO MACROD1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of MACROD1 mRNA CTD PMID:32234424 Macrod1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of MACROD1 mRNA CTD PMID:24136188 Macrod1 Rat nickel atom decreases expression ISO MACROD1 (Homo sapiens) 6480464 Nickel results in decreased expression of MACROD1 mRNA CTD PMID:25583101 Macrod1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of MACROD1 mRNA CTD PMID:24136188 Macrod1 Rat nitrates multiple interactions ISO Macrod1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MACROD1 mRNA CTD PMID:35964746 Macrod1 Rat okadaic acid decreases expression ISO MACROD1 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of MACROD1 mRNA CTD PMID:38832940 Macrod1 Rat ozone multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the methylation of MACROD1 gene CTD PMID:35835166 Macrod1 Rat paracetamol affects expression ISO Macrod1 (Mus musculus) 6480464 Acetaminophen affects the expression of MACROD1 mRNA CTD PMID:17562736 Macrod1 Rat paracetamol decreases expression ISO MACROD1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MACROD1 mRNA CTD PMID:22230336 Macrod1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of MACROD1 mRNA CTD PMID:32680482 Macrod1 Rat PCB138 multiple interactions ISO Macrod1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Macrod1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MACROD1 mRNA CTD PMID:35163327 Macrod1 Rat perfluorooctanoic acid increases expression ISO MACROD1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MACROD1 protein CTD PMID:26879310 Macrod1 Rat phenobarbital decreases expression ISO Macrod1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of MACROD1 mRNA CTD PMID:19482888 Macrod1 Rat phenobarbital multiple interactions ISO Macrod1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of MACROD1 mRNA] CTD PMID:19482888 Macrod1 Rat phenylmercury acetate decreases expression ISO MACROD1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of MACROD1 mRNA CTD PMID:26272509 Macrod1 Rat phenylmercury acetate multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MACROD1 mRNA CTD PMID:27188386 Macrod1 Rat piperonyl butoxide multiple interactions ISO Macrod1 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of MACROD1 gene CTD PMID:23968726 Macrod1 Rat pirinixic acid decreases expression ISO Macrod1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MACROD1 mRNA CTD PMID:23811191 Macrod1 Rat propiconazole decreases expression ISO Macrod1 (Mus musculus) 6480464 propiconazole results in decreased expression of MACROD1 mRNA CTD PMID:21278054 Macrod1 Rat quercetin decreases expression ISO MACROD1 (Homo sapiens) 6480464 Quercetin results in decreased expression of MACROD1 mRNA CTD PMID:21632981 Macrod1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of MACROD1 mRNA CTD PMID:19013527 Macrod1 Rat SB 431542 multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MACROD1 mRNA CTD PMID:27188386 Macrod1 Rat sodium arsenite decreases expression ISO MACROD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MACROD1 mRNA CTD PMID:38568856 Macrod1 Rat sodium arsenite multiple interactions ISO MACROD1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MACROD1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MACROD1 mRNA CTD PMID:39836092 Macrod1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of MACROD1 mRNA CTD PMID:25993096 Macrod1 Rat sodium fluoride decreases expression ISO Macrod1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of MACROD1 protein CTD PMID:28918527 Macrod1 Rat sulforaphane increases expression ISO Macrod1 (Mus musculus) 6480464 sulforaphane results in increased expression of MACROD1 mRNA CTD PMID:30529165 Macrod1 Rat sunitinib increases expression ISO MACROD1 (Homo sapiens) 6480464 Sunitinib results in increased expression of MACROD1 mRNA CTD PMID:31533062 Macrod1 Rat testosterone multiple interactions ISO Macrod1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Macrod1 Rat testosterone decreases expression ISO Macrod1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of MACROD1 mRNA CTD PMID:33848595 Macrod1 Rat tetrachloromethane decreases expression ISO Macrod1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MACROD1 mRNA CTD PMID:27339419 and PMID:31919559 Macrod1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MACROD1 mRNA CTD PMID:31150632 Macrod1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MACROD1 mRNA CTD PMID:23411599 and PMID:34492290 Macrod1 Rat titanium dioxide decreases methylation ISO Macrod1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MACROD1 gene CTD PMID:35295148 Macrod1 Rat titanium dioxide increases methylation ISO Macrod1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of MACROD1 gene CTD PMID:35295148 Macrod1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MACROD1 mRNA CTD PMID:33387578 Macrod1 Rat triticonazole increases expression EXP 6480464 triticonazole results in increased expression of MACROD1 mRNA CTD PMID:36084822 Macrod1 Rat tunicamycin increases expression ISO MACROD1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of MACROD1 mRNA CTD PMID:29453283 Macrod1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of MACROD1 mRNA CTD PMID:24136188 Macrod1 Rat valproic acid affects expression ISO Macrod1 (Mus musculus) 6480464 Valproic Acid affects the expression of MACROD1 mRNA CTD PMID:17963808 Macrod1 Rat valproic acid affects expression ISO MACROD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MACROD1 mRNA CTD PMID:25979313 Macrod1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MACROD1 mRNA CTD PMID:19015723
1,1-dichloroethene (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dinitrotoluene (EXP) 2,5-hexanedione (EXP) 3-chloropropane-1,2-diol (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) cantharidin (ISO) carbamazepine (ISO) carbendazim (EXP) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) clobetasol (ISO) Cuprizon (EXP) cyclosporin A (ISO) dieldrin (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) fenthion (ISO) fipronil (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) mitoxantrone (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitrates (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) propiconazole (ISO) quercetin (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sodium fluoride (ISO) sulforaphane (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triticonazole (EXP) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP)
Macrod1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,675,413 - 213,831,571 (+) NCBI GRCr8 mRatBN7.2 1 204,246,238 - 204,387,027 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,246,166 - 204,389,716 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,596,116 - 212,736,945 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,691,528 - 219,832,257 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,382,579 - 212,523,308 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,310,916 - 222,451,485 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,310,920 - 222,451,484 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,301,706 - 229,442,053 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,730,907 - 209,871,392 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,889,336 - 210,029,821 (+) NCBI Celera 1 201,779,880 - 201,919,740 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
MACROD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 63,998,558 - 64,166,113 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 63,998,558 - 64,166,113 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 63,766,030 - 63,933,585 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 63,522,606 - 63,690,094 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 61,092,805 - 61,259,693 (-) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 60,094,651 - 60,262,257 (-) NCBI HuRef CHM1_1 11 63,649,362 - 63,816,761 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 63,988,261 - 64,156,074 (-) NCBI T2T-CHM13v2.0
Macrod1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 7,034,065 - 7,175,427 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 7,034,178 - 7,175,422 (+) Ensembl GRCm39 Ensembl GRCm38 19 7,056,728 - 7,198,062 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 7,056,810 - 7,198,057 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 7,131,258 - 7,272,552 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 7,123,854 - 7,265,101 (+) NCBI MGSCv36 mm8 Celera 19 6,833,702 - 6,974,873 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 5.17 NCBI
Macrod1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 20,906,521 - 21,046,345 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 20,906,406 - 21,046,448 (+) NCBI ChiLan1.0 ChiLan1.0
MACROD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 65,225,170 - 65,395,360 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 66,270,344 - 66,440,420 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 59,355,525 - 59,525,620 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 62,702,882 - 62,872,214 (-) NCBI panpan1.1 PanPan1.1 panPan2
MACROD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 52,883,335 - 53,033,490 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 52,883,362 - 53,162,034 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 51,489,863 - 51,639,723 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 53,928,478 - 54,078,350 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 53,928,502 - 54,078,349 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 53,031,114 - 53,180,737 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 52,606,591 - 52,756,405 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 53,390,848 - 53,540,728 (+) NCBI UU_Cfam_GSD_1.0
Macrod1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 8,576,259 - 8,712,495 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 5,018,770 - 5,154,491 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 5,018,636 - 5,154,844 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MACROD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 7,939,125 - 8,088,595 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 7,939,125 - 8,087,656 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 7,054,730 - 7,204,542 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MACROD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 10,072,238 - 10,247,121 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 10,072,263 - 10,250,203 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 107,414,491 - 107,583,049 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Macrod1
.
Predicted Target Of
Count of predictions: 54 Count of miRNA genes: 51 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000028749 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH135442
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 204,259,288 - 204,259,469 (+) MAPPER mRatBN7.2 Rnor_6.0 1 222,323,985 - 222,324,165 NCBI Rnor6.0 Rnor_5.0 1 229,314,750 - 229,314,930 UniSTS Rnor5.0 RGSC_v3.4 1 209,743,755 - 209,743,935 UniSTS RGSC3.4 Celera 1 201,792,698 - 201,792,878 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028749 ⟹ ENSRNOP00000028749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,253,293 - 204,387,011 (+) Ensembl Rnor_6.0 Ensembl 1 222,311,253 - 222,451,484 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091465 ⟹ ENSRNOP00000073401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,246,166 - 204,387,025 (+) Ensembl Rnor_6.0 Ensembl 1 222,310,920 - 222,451,153 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106741 ⟹ ENSRNOP00000097100
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,246,222 - 204,389,716 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111101 ⟹ ENSRNOP00000082162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,253,293 - 204,387,011 (+) Ensembl
RefSeq Acc Id:
NM_139337 ⟹ NP_647553
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,477 - 213,816,211 (+) NCBI mRatBN7.2 1 204,246,279 - 204,387,026 (+) NCBI Rnor_6.0 1 222,311,253 - 222,451,485 (+) NCBI Rnor_5.0 1 229,301,706 - 229,442,053 (+) NCBI RGSC_v3.4 1 209,730,907 - 209,871,392 (+) RGD Celera 1 201,779,880 - 201,919,740 (+) RGD
Sequence:
GCGGCAGGGCGTGGAGCCTGGGTGCGCACCTGGGCCCCCCTGGCCATGGCCGCGAAGGTGGACCTGAGCACCTCCACCGACTGGAAGGAGGCCAAATCCTTTCTGAAGGGCCTGAGTGACAAGCAGAG
hide sequence
RefSeq Acc Id:
XM_006230677 ⟹ XP_006230739
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,413 - 213,831,571 (+) NCBI mRatBN7.2 1 204,246,248 - 204,387,027 (+) NCBI Rnor_6.0 1 222,310,916 - 222,451,485 (+) NCBI Rnor_5.0 1 229,301,706 - 229,442,053 (+) NCBI
Sequence:
GCCGCCCGCGGTCTCTAAGCAGGTCGCCACGGGCTGGCACGCGCCACTCTCGTCCCAGAGTAAA
hide sequence
RefSeq Acc Id:
XM_039099824 ⟹ XP_038955752
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,686,772 (+) NCBI mRatBN7.2 1 204,246,238 - 204,262,837 (+) NCBI
RefSeq Acc Id:
XM_039099857 ⟹ XP_038955785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,733,917 (+) NCBI mRatBN7.2 1 204,246,239 - 204,303,428 (+) NCBI
RefSeq Acc Id:
XM_039099901 ⟹ XP_038955829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,711,334 (+) NCBI mRatBN7.2 1 204,246,239 - 204,283,265 (+) NCBI
RefSeq Acc Id:
XM_039099939 ⟹ XP_038955867
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,760,101 (+) NCBI mRatBN7.2 1 204,246,240 - 204,343,141 (+) NCBI
RefSeq Acc Id:
XM_039099975 ⟹ XP_038955903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,719,955 (+) NCBI mRatBN7.2 1 204,246,240 - 204,300,885 (+) NCBI
RefSeq Acc Id:
XM_063280960 ⟹ XP_063137030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,430 - 213,793,012 (+) NCBI
RefSeq Acc Id:
XR_010063054
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,675,413 - 213,831,571 (+) NCBI
RefSeq Acc Id:
NP_647553 ⟸ NM_139337
- UniProtKB:
A0A0G2K5F1 (UniProtKB/TrEMBL), A6HZN3 (UniProtKB/TrEMBL)
- Sequence:
MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPMWKETAKGLAGKVENPKYKKDKQLNEKISLFRGDITKLEVDAIVNAANNSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKA
hide sequence
RefSeq Acc Id:
XP_006230739 ⟸ XM_006230677
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AN55 (UniProtKB/TrEMBL)
- Sequence:
MSLQSQVSGRLAQLRVAGQLLVSPRPWPGRSAGGPRPRGSAYGPLVALGQHGYCAWPSAGVGAWGAAGRGAWVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPMWKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000028749 ⟸ ENSRNOT00000028749
Ensembl Acc Id:
ENSRNOP00000073401 ⟸ ENSRNOT00000091465
RefSeq Acc Id:
XP_038955752 ⟸ XM_039099824
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038955785 ⟸ XM_039099857
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038955829 ⟸ XM_039099901
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038955867 ⟸ XM_039099939
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038955903 ⟸ XM_039099975
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000082162 ⟸ ENSRNOT00000111101
Ensembl Acc Id:
ENSRNOP00000097100 ⟸ ENSRNOT00000106741
RefSeq Acc Id:
XP_063137030 ⟸ XM_063280960
- Peptide Label:
isoform X2
RGD ID: 13690732 Promoter ID: EPDNEW_R1242 Type: initiation region Name: Macrod1_1 Description: MACRO domain containing 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 222,310,961 - 222,311,021 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
Macrod1
mono-ADP ribosylhydrolase 1
Macrod1
MACRO domain containing 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-25
Macrod1
MACRO domain containing 1
Lrp16
LRP16 protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Lrp16
LRP16 protein
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Lrp16
LRP16 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
