Advanced Search (OLGA)

Gene: Vax2 (ventral anterior homeobox 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Vax2

Name:

ventral anterior homeobox 2

RGD ID:

621133

Description:

Predicted to enable DNA binding activity and DNA-binding transcription repressor activity, RNA polymerase II-specific. Predicted to be involved in forebrain development; neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including dorsal/ventral axis specification; eye development; and negative regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human VAX2 (ventral anterior homeobox 2); INTERACTS WITH 17alpha-ethynylestradiol; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ventral anterior homeobox containing gene 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VAX2 (ventral anterior homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Vax2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vax2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VAX2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VAX2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vax2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VAX2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VAX2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vax2 (ventral anterior homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	VAX1 (ventral anterior homeobox 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	VAX2 (ventral anterior homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Vax2 (ventral anterior homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vax2 (ventral anterior homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-5	Alliance	DIOPT (OrthoInspector\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	117,753,180 - 117,777,242 (+)	NCBI		GRCr8
mRatBN7.2	4	116,195,528 - 116,219,597 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	116,195,528 - 116,219,594 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	121,674,313 - 121,698,030 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	117,449,490 - 117,473,203 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	116,063,178 - 116,086,845 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	115,388,839 - 115,412,515 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	115,388,839 - 115,412,515 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	179,975,806 - 180,001,477 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	117,903,748 - 117,927,411 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	118,148,228 - 118,171,892 (+)	NCBI
Celera	4	105,188,167 - 105,211,754 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vax2	Rat	dystonia		ISO	RGD:731657	8554872	ClinVar Annotator: match by term: Dystonia	ClinVar	PMID:16697227\|PMID:16752391\|PMID:22522443\|PMID:23542699\|PMID:28492532\|PMID:30682498
Vax2	Rat	Methylmalonyl-CoA Epimerase Deficiency		ISO	RGD:731657	8554872	ClinVar Annotator: match by term: METHYLMALONIC ACIDURIA III	ClinVar	PMID:16697227\|PMID:16752391\|PMID:22522443\|PMID:23542699\|PMID:28492532\|PMID:30682498
Vax2	Rat	syndromic microphthalmia 5		ISO	RGD:731657	8554872	ClinVar Annotator: match by term: Anophthalmia-microphthalmia syndrome	ClinVar	PMID:26893459

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vax2	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of VAX2 mRNA	CTD	PMID:15212814
Vax2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:731658	6480464	Tetrachlorodibenzodioxin results in increased expression of VAX2 mRNA	CTD	PMID:24058054
Vax2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:731658	6480464	Tetrachlorodibenzodioxin affects the expression of VAX2 mRNA	CTD	PMID:21570461
Vax2	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of VAX2 mRNA	CTD	PMID:35163327
Vax2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of VAX2 mRNA	CTD	PMID:16483693
Vax2	Rat	amosite asbestos	decreases methylation	ISO	RGD:731657	6480464	Asbestos, Amosite results in decreased methylation of VAX2 promoter	CTD	PMID:29626692
Vax2	Rat	arsane	affects methylation	ISO	RGD:731657	6480464	Arsenic affects the methylation of VAX2 gene	CTD	PMID:25304211
Vax2	Rat	arsane	multiple interactions	ISO	RGD:731657	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAX2 more ...	CTD	PMID:39836092
Vax2	Rat	arsenic atom	affects methylation	ISO	RGD:731657	6480464	Arsenic affects the methylation of VAX2 gene	CTD	PMID:25304211
Vax2	Rat	arsenic atom	multiple interactions	ISO	RGD:731657	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAX2 more ...	CTD	PMID:39836092
Vax2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:731657	6480464	Benzo(a)pyrene results in increased methylation of VAX2 promoter	CTD	PMID:27901495
Vax2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of VAX2 mRNA	CTD	PMID:25181051
Vax2	Rat	bisphenol A	multiple interactions	ISO	RGD:731657	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of VAX2 gene	CTD	PMID:31601247
Vax2	Rat	bisphenol A	decreases methylation	ISO	RGD:731657	6480464	bisphenol A results in decreased methylation of VAX2 gene	CTD	PMID:31601247
Vax2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of VAX2 mRNA	CTD	PMID:32145629
Vax2	Rat	bisphenol A	affects methylation	ISO	RGD:731658	6480464	bisphenol A affects the methylation of VAX2 promoter	CTD	PMID:27334623
Vax2	Rat	cadmium atom	multiple interactions	ISO	RGD:731657	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of VAX2 more ...	CTD	PMID:35301059
Vax2	Rat	cadmium dichloride	multiple interactions	ISO	RGD:731657	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of VAX2 more ...	CTD	PMID:35301059
Vax2	Rat	caffeine	increases phosphorylation	ISO	RGD:731657	6480464	Caffeine results in increased phosphorylation of VAX2 protein	CTD	PMID:35688186
Vax2	Rat	chlorpyrifos	increases expression	ISO	RGD:731658	6480464	Chlorpyrifos results in increased expression of VAX2 mRNA	CTD	PMID:37019170
Vax2	Rat	choline	multiple interactions	ISO	RGD:731658	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Vax2	Rat	cisplatin	decreases expression	ISO	RGD:731657	6480464	Cisplatin results in decreased expression of VAX2 mRNA	CTD	PMID:27392435
Vax2	Rat	coumarin	increases phosphorylation	ISO	RGD:731657	6480464	coumarin results in increased phosphorylation of VAX2 protein	CTD	PMID:35688186
Vax2	Rat	crocidolite asbestos	decreases methylation	ISO	RGD:731657	6480464	Asbestos, Crocidolite results in decreased methylation of VAX2 promoter	CTD	PMID:29626692
Vax2	Rat	cyclosporin A	decreases expression	ISO	RGD:731657	6480464	Cyclosporine results in decreased expression of VAX2 mRNA	CTD	PMID:25562108
Vax2	Rat	D-gluconic acid	multiple interactions	EXP		6480464	[gluconic acid co-treated with Deoxycholic Acid] results in increased expression of VAX2 mRNA	CTD	PMID:16556975
Vax2	Rat	deoxycholic acid	multiple interactions	EXP		6480464	[gluconic acid co-treated with Deoxycholic Acid] results in increased expression of VAX2 mRNA	CTD	PMID:16556975
Vax2	Rat	dicyclanil	increases expression	ISO	RGD:731658	6480464	dicyclanil results in increased expression of VAX2 mRNA	CTD	PMID:15664270
Vax2	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of VAX2 mRNA	CTD	PMID:29391264
Vax2	Rat	ethylparaben	increases expression	ISO	RGD:731657	6480464	ethyl-p-hydroxybenzoate results in increased expression of VAX2 mRNA	CTD	PMID:37690743
Vax2	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of VAX2 mRNA	CTD	PMID:30307764
Vax2	Rat	folic acid	multiple interactions	ISO	RGD:731658	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Vax2	Rat	folic acid	decreases expression	ISO	RGD:731658	6480464	Folic Acid results in decreased expression of VAX2 mRNA	CTD	PMID:25629700
Vax2	Rat	fulvestrant	multiple interactions	ISO	RGD:731657	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of VAX2 gene	CTD	PMID:31601247
Vax2	Rat	L-methionine	multiple interactions	ISO	RGD:731658	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Vax2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of VAX2 mRNA	CTD	PMID:33387578
Vax2	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	RGD:731658	6480464	perfluorohexanesulfonic acid results in decreased expression of VAX2 mRNA	CTD	PMID:37995155
Vax2	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of VAX2 mRNA	CTD	PMID:35163327
Vax2	Rat	pirinixic acid	multiple interactions	ISO	RGD:731657	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Vax2	Rat	potassium dichromate	decreases expression	ISO	RGD:731658	6480464	Potassium Dichromate results in decreased expression of VAX2 mRNA	CTD	PMID:23608068
Vax2	Rat	progesterone	increases expression	EXP		6480464	Progesterone results in increased expression of VAX2 mRNA	CTD	PMID:20726854
Vax2	Rat	sodium arsenite	decreases expression	ISO	RGD:731657	6480464	sodium arsenite results in decreased expression of VAX2 mRNA	CTD	PMID:34032870
Vax2	Rat	sodium arsenite	multiple interactions	ISO	RGD:731657	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAX2 more ...	CTD	PMID:39836092
Vax2	Rat	titanium dioxide	decreases expression	ISO	RGD:731658	6480464	titanium dioxide results in decreased expression of VAX2 mRNA	CTD	PMID:29264374
Vax2	Rat	titanium dioxide	decreases methylation	ISO	RGD:731658	6480464	titanium dioxide results in decreased methylation of VAX2 gene	CTD	PMID:35295148
Vax2	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of VAX2 mRNA	CTD	PMID:35594946

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vax2	Rat	axonogenesis	acts_upstream_of_or_within	ISO	RGD:731658	1624291	MGI:2159246 PMID:11830579	RGD	PMID:11830579
Vax2	Rat	axonogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	brain development	involved_in	IBA	MGI:1277163\|MGI:1346018\|MGI:95387\|MGI:95388\|MGI:95842\|PANTHER:PTN000678140\|ZFIN:ZDB-GENE-990415-53\|ZFIN:ZDB-GENE-990415-54	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	camera-type eye development	acts_upstream_of_or_within	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	camera-type eye development	acts_upstream_of_or_within	ISO	RGD:731658	1624291	MGI:1277163 PMID:15905411	RGD	PMID:15905411
Vax2	Rat	central nervous system development	involved_in	IBA	FB:FBgn0025776\|MGI:1277163\|MGI:1346018\|MGI:95387\|MGI:95388\|MGI:95842\|PANTHER:PTN001551821\|ZFIN:ZDB-GENE-990415-53\|ZFIN:ZDB-GENE-990415-54	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	dorsal/ventral axis specification	acts_upstream_of_or_within	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	dorsal/ventral axis specification	acts_upstream_of_or_within	ISO	RGD:731658	1624291	MGI:2159246\|MGI:2388160 PMID:11830578, PMID:11830579	RGD	PMID:11830578\|PMID:11830579
Vax2	Rat	embryonic eye morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	embryonic eye morphogenesis	acts_upstream_of_or_within	ISO	RGD:731658	1624291	MGI:2159246 PMID:10595508, PMID:11830579	RGD	PMID:10595508\|PMID:11830579
Vax2	Rat	forebrain development	involved_in	ISS	UniProtKB:Q9WTP9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Vax2	Rat	forebrain development	involved_in	ISO	RGD:731658	1624291	PMID:21856776	RGD	PMID:21856776
Vax2	Rat	forebrain development	involved_in	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:731658	1624291	MGI:1277163\|MGI:97486 PMID:15905411	RGD	PMID:15905411
Vax2	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:731658	1624291	PMID:15905411	RGD	PMID:15905411
Vax2	Rat	neuron differentiation	involved_in	IBA	MGI:1277163\|MGI:1346018\|MGI:95387\|MGI:95388\|MGI:95842\|PANTHER:PTN001551821\|ZFIN:ZDB-GENE-990415-53\|ZFIN:ZDB-GENE-990415-54	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Vax2	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0025776\|MGI:1277163\|MGI:1346018\|MGI:95842\|PANTHER:PTN001216730\|UniProtKB:Q9H4S2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	retina development in camera-type eye	acts_upstream_of_or_within	ISO	RGD:731658	1624291	PMID:10595508	RGD	PMID:10595508
Vax2	Rat	retina development in camera-type eye	acts_upstream_of_or_within	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	Wnt signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0879	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vax2	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	cytoplasm	located_in	ISO	RGD:731658	1624291	PMID:17043310	RGD	PMID:17043310
Vax2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Vax2	Rat	nucleus	located_in	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Vax2	Rat	nucleus	is_active_in	IBA	FB:FBgn0025776\|MGI:1277163\|MGI:1346018\|MGI:95387\|PANTHER:PTN001216730\|UniProtKB:Q04741\|WB:WBGene00000429	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	nucleus	located_in	ISO	RGD:731658	1624291	PMID:17043310	RGD	PMID:17043310
Vax2	Rat	nucleus	located_in	IEA	UniRule:UR000401037	1600115	GO_REF:0000104	UniProt	GO_REF:0000104

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vax2	Rat	chromatin DNA binding	enables	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	chromatin DNA binding	enables	ISO	RGD:731658	1624291	PMID:15905411	RGD	PMID:15905411
Vax2	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238\|UniProtKB-KW:KW-0371	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Vax2	Rat	DNA binding	enables	IEA	UniRule:UR000401037	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Vax2	Rat	DNA binding	enables	IEA	InterPro:IPR000047\|InterPro:IPR001356\|InterPro:IPR020479	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Vax2	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR017970	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Vax2	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:1277163\|MGI:1346018\|MGI:95842\|PANTHER:PTN001216730	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	RGD:731658	1624291	PMID:15905411	RGD	PMID:15905411
Vax2	Rat	protein binding	enables	ISO	RGD:731657	1624291	UniProtKB:P78424\|UniProtKB:Q6NVU6\|UniProtKB:Q99471 PMID:32296183	RGD	PMID:32296183
Vax2	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:95842\|PANTHER:PTN001216730	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vax2	Rat	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q9WTP9\|ensembl:ENSMUSP00000035976	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vax2	Rat	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	enables	ISO	RGD:731658	1624291	PMID:15905411	RGD	PMID:15905411
Vax2	Rat	sequence-specific double-stranded DNA binding	enables	ISO	RGD:731657	1624291	PMID:28473536	RGD	PMID:28473536
Vax2	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:Q9UIW0\|ensembl:ENSP00000234392	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	A homeobox gene, vax2, controls the patterning of the eye dorsoventral axis.	Barbieri AM, etal., Proc Natl Acad Sci U S A 1999 Sep 14;96(19):10729-34.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10595508	PMID:11830578	PMID:11830579	PMID:15905411	PMID:17043310	PMID:21856776

Vax2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	117,753,180 - 117,777,242 (+)	NCBI		GRCr8
mRatBN7.2	4	116,195,528 - 116,219,597 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	116,195,528 - 116,219,594 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	121,674,313 - 121,698,030 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	117,449,490 - 117,473,203 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	116,063,178 - 116,086,845 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	115,388,839 - 115,412,515 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	115,388,839 - 115,412,515 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	179,975,806 - 180,001,477 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	117,903,748 - 117,927,411 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	118,148,228 - 118,171,892 (+)	NCBI
Celera	4	105,188,167 - 105,211,754 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

VAX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	70,900,576 - 70,933,446 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	70,900,576 - 70,965,373 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	71,127,706 - 71,160,576 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	70,981,228 - 71,014,084 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	71,039,374 - 71,072,228	NCBI
Celera	2	70,978,415 - 71,011,262 (+)	NCBI		Celera
Cytogenetic Map	2	p13.3	NCBI
HuRef	2	70,864,230 - 70,897,075 (+)	NCBI		HuRef
CHM1_1	2	71,057,048 - 71,089,924 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	70,911,643 - 70,944,499 (+)	NCBI		T2T-CHM13v2.0

Vax2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	83,688,221 - 83,715,295 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	83,688,246 - 83,715,295 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	83,711,239 - 83,738,313 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	83,711,264 - 83,738,313 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	83,661,258 - 83,688,298 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	83,676,922 - 83,703,962 (+)	NCBI		MGSCv36	mm8
Celera	6	85,693,897 - 85,720,932 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	35.94	NCBI

Vax2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	14,283,327 - 14,309,809 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	14,283,336 - 14,309,809 (-)	NCBI	ChiLan1.0	ChiLan1.0

VAX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	55,454,485 - 55,487,355 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	55,458,420 - 55,491,315 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	70,964,829 - 70,997,702 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	72,078,829 - 72,111,463 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	72,078,829 - 72,111,463 (+)	Ensembl	panpan1.1		panPan2

VAX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	69,252,926 - 69,262,225 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	69,139,681 - 69,148,943 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	70,256,981 - 70,283,942 (+)	NCBI		ROS_Cfam_1.0
UNSW_CanFamBas_1.0	10	70,254,833 - 70,264,093 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	70,554,177 - 70,563,651 (+)	NCBI		UU_Cfam_GSD_1.0

Vax2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	13,461,054 - 13,491,844 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	15,078,598 - 15,111,252 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936491	15,079,446 - 15,110,238 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VAX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	71,593,812 - 71,622,444 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	71,593,807 - 71,622,487 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	74,973,886 - 74,974,570 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VAX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	36,180,084 - 36,213,534 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	36,180,324 - 36,213,439 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	75,809,094 - 75,842,440 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vax2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	2,481,372 - 2,508,306 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624762	2,480,474 - 2,508,367 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Vax2
93 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	43
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000018128
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat

D4Mit32

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	117,758,621 - 117,758,772 (+)	Marker Load Pipeline
mRatBN7.2	4	116,200,971 - 116,201,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	115,394,252 - 115,394,402	NCBI	Rnor6.0
RGSC_v3.4	4	117,909,147 - 117,909,298	RGD	RGSC3.4
RGSC_v3.4	4	117,909,148 - 117,909,298	UniSTS	RGSC3.4
RGSC_v3.1	4	118,153,567 - 118,154,020	RGD
Celera	4	105,193,513 - 105,193,655	UniSTS
Cytogenetic Map	4	q34	UniSTS

AU048170

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	116,203,758 - 116,203,945 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	115,397,035 - 115,397,221	NCBI	Rnor6.0
Rnor_5.0	4	179,985,996 - 179,986,190	NCBI	Rnor5.0
RGSC_v3.4	4	117,911,931 - 117,912,117	UniSTS	RGSC3.4
Celera	4	105,196,287 - 105,196,460	UniSTS
Cytogenetic Map	4	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	7	16	83	54	55	25	23	25	6	102	57	65	8	47	30


RefSeq Transcripts	NM_022637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF113516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018128 ⟹ ENSRNOP00000018128

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	116,195,528 - 116,219,594 (+)	Ensembl
Rnor_6.0 Ensembl	4	115,388,839 - 115,412,515 (+)	Ensembl

RefSeq Acc Id:

NM_022637 ⟹ NP_072159

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	117,753,180 - 117,777,242 (+)	NCBI
mRatBN7.2	4	116,195,528 - 116,219,597 (+)	NCBI
Rnor_6.0	4	115,388,839 - 115,412,515 (+)	NCBI
Rnor_5.0	4	179,975,806 - 180,001,477 (+)	NCBI
RGSC_v3.4	4	117,903,748 - 117,927,411 (+)	RGD
Celera	4	105,188,167 - 105,211,754 (+)	RGD

Sequence:

show sequence

ATGGGCGATGGGGGCGCGGAGCGGGACCGCGGCCCCAAGCGCCGGGAGGAGCCTGGTGGCCGCAGCGGGTGTCGTGGGGAGCACCGCGGAGCGGAAGATTTGCGTGCTGACACGGGTAGCACGAGTCC
GAGGGAGATTGCTGGGACCTCCGCCTCCAGCCCTGCAGGCTCCAGGGAGAGCGGCGGGGACAGCGACGGACAACAGGCGCTCGGTGAGACGGACCACTGCCGCCGCATCCTGGTACGAGATGCCAAGG
GGACCATTCGGGAAATTGTCCTGCCCAAGGGCCTGGACCTCGACCGACCCAAGAGGACCCGTACCTCCTTCACAGCAGAACAGCTGTATCGTTTGGAGATGGAGTTCCAGCGCTGCCAGTATGTGGTG
GGCCGAGAGCGCACAGAGCTGGCCCGCCAGCTGAACCTCTCTGAGACTCAGGTGAAGGTCTGGTTCCAGAACCGCCGCACCAAGCAGAAGAAGGACCAGAGCAGAGACCTGGAAAAGCGGGCATCCTC
CTCCGCCTTCGAGGCCTTTGCCACCTCCAACGTTCTGCGACTTCTGGAACAGGGCCGGCTGCTCTCCGTGCCCAGAGCTCCCAGCCTCCTAGCACTGAGCCCTGGCCTGCCAGGTCTAACCGCTGGCC
ACAGGGGCACCTCCTTGGGTGACCCCAGGAACTCCTCCCAACGCCTCAATCCAATGCCCTCAGCCTCAGCGTCGTCCCCTCTGCCACCCCCTCTGCCAGCCGTCTGCTTTTCCGCAGCTCCACTCCTG
GACTTGCCCGCCAGCTACAAACTGGGGTCCTCGGCTTTTGAGCCCTACAGCAGACTAGAACAACAGAAAGTAGGCAGCCCTGGCCAAAGTGACAAGAAAGCTGACATTTAA

hide sequence

RefSeq Acc Id:

XM_039108321 ⟹ XP_038964249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	117,753,337 - 117,777,242 (+)	NCBI
mRatBN7.2	4	116,195,681 - 116,219,597 (+)	NCBI


Protein RefSeqs	NP_072159	(Get FASTA)	NCBI Sequence Viewer
	XP_038964249	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF25691	(Get FASTA)	NCBI Sequence Viewer
	EDL91158	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018128
GenBank Protein	Q9JLZ9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_072159 ⟸ NM_022637

- UniProtKB:

Q9JLZ9 (UniProtKB/Swiss-Prot), G3V7R0 (UniProtKB/TrEMBL), A6IAP0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDGGAERDRGPKRREEPGGRSGCRGEHRGAEDLRADTGSTSPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVV
GRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSAFEAFATSNVLRLLEQGRLLSVPRAPSLLALSPGLPGLTAGHRGTSLGDPRNSSQRLNPMPSASASSPLPPPLPAVCFSAAPLL
DLPASYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI

hide sequence

Ensembl Acc Id:

ENSRNOP00000018128 ⟸ ENSRNOT00000018128

RefSeq Acc Id:	XP_038964249 ⟸ XM_039108321
- Peptide Label:	isoform X1

Protein Domains

Homeobox

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JLZ9-F1-model_v2	AlphaFold	Q9JLZ9	1-292	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693184

Promoter ID:

EPDNEW_R3709

Type:

single initiation site

Name:

Vax2_1

Description:

ventral anterior homeobox 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	115,388,786 - 115,388,846	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-43994	BioCyc
Ensembl Genes	ENSRNOG00000013261	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000018128	ENTREZGENE
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	EMX-VAX-Noto_Homeobox_TFs	UniProtKB/Swiss-Prot
	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Homeobox_metazoa	UniProtKB/Swiss-Prot
	HTH_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:64572	UniProtKB/Swiss-Prot
NCBI Gene	64572	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN EMX-RELATED	UniProtKB/Swiss-Prot
	PTHR24339:SF34	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
PhenoGen	Vax2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/Swiss-Prot
	HTHREPRESSR	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013261	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	A6IAP0	ENTREZGENE, UniProtKB/TrEMBL
	G3V7R0	ENTREZGENE, UniProtKB/TrEMBL
	Q9JLZ9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Vax2	ventral anterior homeobox 2	Vax2	ventral anterior homeobox containing gene 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-19	Vax2	ventral anterior homeobox containing gene 2	Vax2	ventral anterior homeobox 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Vax2	ventral anterior homeobox 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Vax2	ventral anterior homeobox 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar