Symbol:
Prmt3
Name:
protein arginine methyltransferase 3
RGD ID:
620413
Description:
Enables modified amino acid binding activity and protein-arginine omega-N asymmetric methyltransferase activity. Involved in dendritic spine morphogenesis and peptidyl-arginine methylation, to asymmetrical-dimethyl arginine. Predicted to be located in cytosol. Predicted to be active in nucleus. Biomarker of asthma. Orthologous to human PRMT3 (protein arginine methyltransferase 3); PARTICIPATES IN histidine metabolic pathway; histidinemia pathway; homocysteine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
heterogeneous nuclear ribonucleoprotein methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae); heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; Hrmt1l3; protein arginine N-methyltransferase 3; protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 108,628,899 - 108,718,803 (+) NCBI GRCr8 mRatBN7.2 1 99,492,712 - 99,581,774 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 99,492,724 - 99,579,435 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 104,846,834 - 104,933,517 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 113,318,757 - 113,405,436 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 106,641,014 - 106,727,679 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 105,113,595 - 105,200,253 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 105,113,595 - 105,200,470 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 106,163,799 - 106,250,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 99,581,943 - 99,668,604 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 99,660,053 - 99,746,714 (+) NCBI Celera 1 93,691,794 - 93,778,258 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prmt3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PRMT3 mRNA] CTD PMID:31150632 Prmt3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRMT3 mRNA CTD PMID:22079256 Prmt3 Rat (1->4)-beta-D-glucan multiple interactions ISO Prmt3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRMT3 mRNA CTD PMID:36331819 Prmt3 Rat 1,2-dimethylhydrazine affects expression ISO Prmt3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of PRMT3 mRNA CTD PMID:22206623 Prmt3 Rat 1-nitropyrene increases expression ISO PRMT3 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of PRMT3 mRNA CTD PMID:19041380 Prmt3 Rat 17beta-estradiol increases expression ISO PRMT3 (Homo sapiens) 6480464 Estradiol results in increased expression of PRMT3 mRNA CTD PMID:31614463 Prmt3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Prmt3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Prmt3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO PRMT3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of PRMT3 mRNA CTD PMID:22574217 Prmt3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRMT3 mRNA CTD PMID:33387578 Prmt3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Prmt3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRMT3 mRNA CTD PMID:19465110 and PMID:19770486 Prmt3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prmt3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRMT3 mRNA CTD PMID:21570461 Prmt3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PRMT3 mRNA CTD PMID:21346803 Prmt3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PRMT3 mRNA CTD PMID:21346803 Prmt3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRMT3 mRNA CTD PMID:28628672 Prmt3 Rat 4,4'-sulfonyldiphenol increases expression ISO Prmt3 (Mus musculus) 6480464 bisphenol S results in increased expression of PRMT3 mRNA CTD PMID:39298647 Prmt3 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PRMT3 mRNA CTD PMID:28959563 Prmt3 Rat acrylamide increases expression ISO PRMT3 (Homo sapiens) 6480464 Acrylamide results in increased expression of PRMT3 mRNA CTD PMID:32763439 Prmt3 Rat all-trans-retinoic acid decreases expression ISO PRMT3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PRMT3 mRNA CTD PMID:33167477 Prmt3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRMT3 mRNA CTD PMID:16483693 Prmt3 Rat aristolochic acid A decreases expression ISO PRMT3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PRMT3 mRNA CTD PMID:33212167 Prmt3 Rat arsane multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat arsenic atom multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat arsenite(3-) multiple interactions ISO PRMT3 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PRMT3 mRNA] CTD PMID:32406909 Prmt3 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PRMT3 gene CTD PMID:35440735 Prmt3 Rat Benoxacor decreases expression ISO Prmt3 (Mus musculus) 6480464 benoxacor results in decreased expression of PRMT3 mRNA CTD PMID:34850242 Prmt3 Rat benzo[a]pyrene decreases expression ISO Prmt3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PRMT3 mRNA CTD PMID:19770486 and PMID:21715664 Prmt3 Rat benzo[a]pyrene increases methylation ISO PRMT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PRMT3 promoter CTD PMID:27901495 Prmt3 Rat benzo[a]pyrene increases expression ISO Prmt3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PRMT3 mRNA CTD PMID:22228805 Prmt3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRMT3 mRNA CTD PMID:32145629 Prmt3 Rat bisphenol A increases expression ISO Prmt3 (Mus musculus) 6480464 bisphenol A results in increased expression of PRMT3 mRNA CTD PMID:33221593 Prmt3 Rat bisphenol F multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRMT3 mRNA CTD PMID:28628672 Prmt3 Rat cadmium dichloride increases expression ISO PRMT3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRMT3 mRNA CTD PMID:26472689 Prmt3 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of PRMT3 mRNA CTD PMID:20864626 Prmt3 Rat carbon nanotube increases expression ISO Prmt3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Prmt3 Rat chromium(6+) affects expression ISO Prmt3 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PRMT3 mRNA CTD PMID:28472532 Prmt3 Rat cisplatin increases expression ISO Prmt3 (Mus musculus) 6480464 Cisplatin results in increased expression of PRMT3 protein CTD PMID:31256211 Prmt3 Rat cisplatin multiple interactions ISO Prmt3 (Mus musculus) 6480464 Cisplatin promotes the reaction [PRMT3 protein binds to FAAH protein] more ... CTD PMID:31256211 Prmt3 Rat cobalt dichloride decreases expression ISO PRMT3 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PRMT3 mRNA CTD PMID:19376846 Prmt3 Rat crocidolite asbestos increases expression ISO Prmt3 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PRMT3 mRNA CTD PMID:19446018 Prmt3 Rat cyclosporin A increases expression ISO PRMT3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRMT3 mRNA CTD PMID:20106945 Prmt3 Rat DDE increases expression ISO PRMT3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PRMT3 mRNA CTD PMID:38568856 Prmt3 Rat dexamethasone decreases expression ISO PRMT3 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PRMT3 mRNA CTD PMID:12782123 Prmt3 Rat dexamethasone multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRMT3 mRNA CTD PMID:28628672 Prmt3 Rat Dibutyl phosphate affects expression ISO PRMT3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PRMT3 mRNA CTD PMID:37042841 Prmt3 Rat dibutyl phthalate decreases expression ISO Prmt3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PRMT3 mRNA CTD PMID:21266533 Prmt3 Rat dicrotophos decreases expression ISO PRMT3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PRMT3 mRNA CTD PMID:28302478 Prmt3 Rat dioxygen decreases expression ISO PRMT3 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of PRMT3 mRNA CTD PMID:26516004 Prmt3 Rat dioxygen multiple interactions ISO Prmt3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PRMT3 mRNA CTD PMID:30529165 Prmt3 Rat doxorubicin decreases expression ISO PRMT3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRMT3 mRNA CTD PMID:29803840 Prmt3 Rat elemental selenium decreases expression ISO PRMT3 (Homo sapiens) 6480464 Selenium results in decreased expression of PRMT3 mRNA CTD PMID:19244175 Prmt3 Rat enzyme inhibitor multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PRMT3 protein CTD PMID:23301498 Prmt3 Rat ethyl methanesulfonate decreases expression ISO PRMT3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PRMT3 mRNA CTD PMID:23649840 Prmt3 Rat fenthion decreases expression ISO Prmt3 (Mus musculus) 6480464 Fenthion results in decreased expression of PRMT3 mRNA CTD PMID:34813904 Prmt3 Rat formaldehyde decreases expression ISO PRMT3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PRMT3 mRNA CTD PMID:23649840 Prmt3 Rat FR900359 affects phosphorylation ISO PRMT3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRMT3 protein CTD PMID:37730182 Prmt3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRMT3 mRNA CTD PMID:33387578 Prmt3 Rat indometacin multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRMT3 mRNA CTD PMID:28628672 Prmt3 Rat ivermectin decreases expression ISO PRMT3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRMT3 protein CTD PMID:32959892 Prmt3 Rat manganese atom multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat manganese(0) multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat manganese(II) chloride multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat methoxyacetic acid decreases expression EXP 6480464 methoxyacetic acid results in decreased expression of PRMT3 mRNA CTD PMID:20864626 Prmt3 Rat methyl methanesulfonate decreases expression ISO PRMT3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PRMT3 mRNA CTD PMID:23649840 Prmt3 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of PRMT3 mRNA CTD PMID:20864626 Prmt3 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of PRMT3 mRNA CTD PMID:20864626 Prmt3 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRMT3 mRNA CTD PMID:28801915 Prmt3 Rat nitrates multiple interactions ISO Prmt3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRMT3 mRNA CTD PMID:35964746 Prmt3 Rat paracetamol affects expression ISO Prmt3 (Mus musculus) 6480464 Acetaminophen affects the expression of PRMT3 mRNA CTD PMID:17562736 Prmt3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PRMT3 mRNA CTD PMID:33387578 Prmt3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PRMT3 mRNA CTD PMID:32680482 Prmt3 Rat pentachlorophenol increases expression ISO Prmt3 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PRMT3 mRNA CTD PMID:23892564 Prmt3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prmt3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRMT3 mRNA CTD PMID:36331819 Prmt3 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PRMT3 mRNA CTD PMID:19162173 Prmt3 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of PRMT3 mRNA CTD PMID:20345932 Prmt3 Rat pirinixic acid increases expression ISO Prmt3 (Mus musculus) 6480464 pirinixic acid results in increased expression of PRMT3 mRNA CTD PMID:18301758 Prmt3 Rat potassium chromate multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRMT3 mRNA CTD PMID:22079256 Prmt3 Rat potassium chromate decreases expression ISO PRMT3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PRMT3 mRNA CTD PMID:22079256 Prmt3 Rat resveratrol multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PRMT3 mRNA CTD PMID:23557933 Prmt3 Rat ribavirin decreases expression ISO PRMT3 (Homo sapiens) 6480464 Ribavirin results in decreased expression of PRMT3 protein CTD PMID:34919946 Prmt3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PRMT3 mRNA CTD PMID:28374803 Prmt3 Rat selenium atom decreases expression ISO PRMT3 (Homo sapiens) 6480464 Selenium results in decreased expression of PRMT3 mRNA CTD PMID:19244175 Prmt3 Rat sodium arsenite decreases expression ISO PRMT3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRMT3 mRNA CTD PMID:38568856 Prmt3 Rat sodium arsenite multiple interactions ISO PRMT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PRMT3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PRMT3 mRNA CTD PMID:39836092 Prmt3 Rat sunitinib increases expression ISO PRMT3 (Homo sapiens) 6480464 Sunitinib results in increased expression of PRMT3 mRNA CTD PMID:31533062 Prmt3 Rat tert-butyl hydroperoxide increases expression ISO PRMT3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PRMT3 mRNA CTD PMID:15336504 Prmt3 Rat tetrachloromethane affects expression ISO Prmt3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PRMT3 mRNA CTD PMID:17484886 Prmt3 Rat tetrachloromethane increases expression ISO Prmt3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PRMT3 mRNA CTD PMID:31919559 Prmt3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PRMT3 mRNA] CTD PMID:31150632 Prmt3 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRMT3 mRNA CTD PMID:31150632 Prmt3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRMT3 mRNA CTD PMID:23411599 and PMID:34492290 Prmt3 Rat thiram decreases expression ISO PRMT3 (Homo sapiens) 6480464 Thiram results in decreased expression of PRMT3 mRNA CTD PMID:38568856 Prmt3 Rat titanium dioxide increases methylation ISO Prmt3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRMT3 gene CTD PMID:35295148 Prmt3 Rat Tributyltin oxide decreases expression ISO Prmt3 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of PRMT3 mRNA CTD PMID:25270620 Prmt3 Rat trichostatin A affects expression ISO PRMT3 (Homo sapiens) 6480464 trichostatin A affects the expression of PRMT3 mRNA CTD PMID:28542535 Prmt3 Rat triphenyl phosphate affects expression ISO PRMT3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRMT3 mRNA CTD PMID:37042841 Prmt3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PRMT3 mRNA CTD PMID:18042343 Prmt3 Rat vitamin E decreases expression ISO PRMT3 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PRMT3 mRNA CTD PMID:19244175
Imported Annotations - SMPDB
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) Benoxacor (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (EXP) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) indometacin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxyacetic acid (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP) Monobutylphthalate (EXP) N-methyl-4-phenylpyridinium (EXP) nitrates (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenytoin (EXP) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) ribavirin (ISO) rotenone (EXP) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) Tributyltin oxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) vinclozolin (EXP) vitamin E (ISO)
1.
Arginine methylation an emerging regulator of protein function.
Bedford MT and Richard S, Mol Cell 2005 Apr 29;18(3):263-72.
2.
Histone arginine methylation.
Di Lorenzo A and Bedford MT, FEBS Lett. 2011 Jul 7;585(13):2024-31. doi: 10.1016/j.febslet.2010.11.010. Epub 2010 Nov 11.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
PRMT3 is essential for dendritic spine maturation in rat hippocampal neurons.
Miyata S, etal., Brain Res. 2010 Sep 17;1352:11-20. doi: 10.1016/j.brainres.2010.07.033. Epub 2010 Jul 18.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
[Expression of protein arginine N-methyltransferases in E3 rat models of acute asthma].
Sun QZ, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2010 Apr;30(4):716-9.
10.
PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.
Tang J, etal., J Biol Chem 1998 Jul 3;273(27):16935-45.
11.
Crystal structure of the conserved core of protein arginine methyltransferase PRMT3.
Zhang X, etal., EMBO J. 2000 Jul 17;19(14):3509-19.
Prmt3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 108,628,899 - 108,718,803 (+) NCBI GRCr8 mRatBN7.2 1 99,492,712 - 99,581,774 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 99,492,724 - 99,579,435 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 104,846,834 - 104,933,517 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 113,318,757 - 113,405,436 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 106,641,014 - 106,727,679 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 105,113,595 - 105,200,253 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 105,113,595 - 105,200,470 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 106,163,799 - 106,250,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 99,581,943 - 99,668,604 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 99,660,053 - 99,746,714 (+) NCBI Celera 1 93,691,794 - 93,778,258 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
PRMT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 20,387,716 - 20,509,338 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 20,387,558 - 20,509,338 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 20,409,262 - 20,530,884 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 20,365,679 - 20,487,349 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 20,541,661 - 20,662,994 (+) NCBI Celera Cytogenetic Map 11 p15.1 NCBI HuRef 11 20,092,368 - 20,214,172 (+) NCBI HuRef CHM1_1 11 20,408,983 - 20,530,723 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 20,508,397 - 20,629,944 (+) NCBI T2T-CHM13v2.0
Prmt3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 49,428,067 - 49,508,016 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 49,428,094 - 49,508,013 (+) Ensembl GRCm39 Ensembl GRCm38 7 49,778,319 - 49,861,264 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 49,778,346 - 49,858,265 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 57,033,728 - 57,113,635 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 49,646,379 - 49,726,286 (+) NCBI MGSCv36 mm8 Celera 7 45,228,154 - 45,308,430 (+) NCBI Celera Cytogenetic Map 7 B4 NCBI cM Map 7 31.44 NCBI
Prmt3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 1,223,076 - 1,331,582 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 1,222,579 - 1,331,582 (+) NCBI ChiLan1.0 ChiLan1.0
PRMT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 22,688,983 - 22,817,065 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 22,648,763 - 22,776,831 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 20,412,419 - 20,538,295 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 20,324,196 - 20,449,681 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 20,324,196 - 20,449,681 (+) Ensembl panpan1.1 panPan2
PRMT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 42,406,327 - 42,530,157 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 42,406,314 - 42,528,116 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 41,882,566 - 42,006,278 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 43,527,769 - 43,650,988 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 43,527,763 - 43,653,579 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 42,529,594 - 42,653,065 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 42,705,438 - 42,829,263 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 43,087,080 - 43,211,034 (+) NCBI UU_Cfam_GSD_1.0
Prmt3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 42,462,572 - 42,589,987 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936654 1,336,429 - 1,461,476 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936654 1,336,546 - 1,464,959 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRMT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 38,884,362 - 39,032,996 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 38,884,311 - 39,032,944 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 41,911,569 - 41,930,041 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRMT3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 44,486,165 - 44,621,002 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 44,485,880 - 44,620,936 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 141,822,116 - 141,955,377 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prmt3
.
Predicted Target Of
Count of predictions: 224 Count of miRNA genes: 146 Interacting mature miRNAs: 173 Transcripts: ENSRNOT00000020853 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH141582
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 99,579,143 - 99,579,339 (+) MAPPER mRatBN7.2 Rnor_6.0 1 105,199,960 - 105,200,155 NCBI Rnor6.0 Rnor_5.0 1 106,250,209 - 106,250,404 UniSTS Rnor5.0 RGSC_v3.4 1 99,668,311 - 99,668,506 UniSTS RGSC3.4 Celera 1 93,777,965 - 93,778,160 UniSTS RH 3.4 Map 1 920.5 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020853 ⟹ ENSRNOP00000020853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 99,492,724 - 99,579,435 (+) Ensembl Rnor_6.0 Ensembl 1 105,113,595 - 105,200,259 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079655 ⟹ ENSRNOP00000069745
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 99,492,724 - 99,579,435 (+) Ensembl Rnor_6.0 Ensembl 1 105,113,658 - 105,200,470 (+) Ensembl
RefSeq Acc Id:
NM_053557 ⟹ NP_446009
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 108,628,924 - 108,718,803 (+) NCBI mRatBN7.2 1 99,492,768 - 99,579,437 (+) NCBI Rnor_6.0 1 105,113,595 - 105,200,253 (+) NCBI Rnor_5.0 1 106,163,799 - 106,250,502 (+) NCBI RGSC_v3.4 1 99,581,943 - 99,668,604 (+) RGD Celera 1 93,691,794 - 93,778,258 (+) RGD
Sequence:
GTTGCTTTGGGGCTACCGCGCGCCCGCGCTCGTTCCCAGCTCCGGTCCCGCGCTGTGCGGTCGCGCGCTTGGTCGGCGGCCATGTGTTCGCTGGCGGCGGGGAACGGACAAGGCGCGGAGCTGGGGCC
hide sequence
RefSeq Acc Id:
XM_039093128 ⟹ XP_038949056
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 108,628,899 - 108,717,950 (+) NCBI mRatBN7.2 1 99,492,712 - 99,581,774 (+) NCBI
RefSeq Acc Id:
NP_446009 ⟸ NM_053557
- UniProtKB:
O70467 (UniProtKB/Swiss-Prot), A6JBG4 (UniProtKB/TrEMBL), A0A8L2QAU2 (UniProtKB/TrEMBL)
- Sequence:
MCSLAAGNGQGAELGPEPLELSDSGDDAGWEDEDADAEPAQGRQHTPCLFCDRLFRSAEETFSHCKLEHQFNIDGMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWDKDEYLKPVLEDDLL
hide sequence
Ensembl Acc Id:
ENSRNOP00000069745 ⟸ ENSRNOT00000079655
Ensembl Acc Id:
ENSRNOP00000020853 ⟸ ENSRNOT00000020853
RefSeq Acc Id:
XP_038949056 ⟸ XM_039093128
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JW52 (UniProtKB/TrEMBL), A0A8L2QAU2 (UniProtKB/TrEMBL)
RGD ID: 13690078 Promoter ID: EPDNEW_R602 Type: multiple initiation site Name: Prmt3_1 Description: protein arginine methyltransferase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 105,113,568 - 105,113,628 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-24
Prmt3
protein arginine methyltransferase 3
Prmt3
protein arginine N-methyltransferase 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-25
Prmt3
protein arginine N-methyltransferase 3
Hrmt1l3
heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Hrmt1l3
heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae)
Prmt3
protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3
Symbol and Name updated
1299863 APPROVED
2002-08-07
Prmt3
protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_other
probably acts as a monomer
729523
