Symbol:
Trpm4
Name:
transient receptor potential cation channel, subfamily M, member 4
RGD ID:
620244
Description:
Enables calcium-activated cation channel activity. Involved in several processes, including long-term memory; negative regulation of osteoblast differentiation; and regulation of blood circulation. Located in several cellular components, including Golgi apparatus; endoplasmic reticulum; and neuronal cell body. Biomarker of cardiac arrest. Human ortholog(s) of this gene implicated in erythrokeratodermia variabilis et progressiva 6 and progressive familial heart block type IB. Orthologous to human TRPM4 (transient receptor potential cation channel subfamily M member 4); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
calcium-activated non-selective cation channel 1; long transient receptor potential channel 4; LTrpC-4; LTrpC4; melastatin like 2 protein; melastatin-like 2; Mls2s; transient receptor potential cation channel subfamily M member 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TRPM4 (transient receptor potential cation channel subfamily M member 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Trpm4 (transient receptor potential cation channel, subfamily M, member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Trpm4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TRPM4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TRPM4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Trpm4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TRPM4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TRPM4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Trpm4 (transient receptor potential cation channel subfamily M member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RPH3AL (rabphilin 3A like (without C2 domains)) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TRPM4 (transient receptor potential cation channel subfamily M member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trpm4 (transient receptor potential cation channel, subfamily M, member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm4a (transient receptor potential cation channel, subfamily M, member 4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm4b.2 (transient receptor potential cation channel, subfamily M, member 4b, transient receptor potential cation channel, subfamily M, member 4b, tandem duplicate 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
trpm4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,918,462 - 104,949,453 (-) NCBI GRCr8 mRatBN7.2 1 95,781,805 - 95,812,095 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,782,000 - 95,812,532 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,167,413 - 101,197,191 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,640,086 - 109,669,864 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,930,482 - 102,960,268 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,293,300 - 101,323,484 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,293,409 - 101,323,960 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,357,043 - 102,387,010 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,773,485 - 95,803,542 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,851,812 - 95,863,602 (-) NCBI Celera 1 90,039,848 - 90,063,911 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trpm4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TRPM4 mRNA] CTD PMID:31150632 Trpm4 Rat (1->4)-beta-D-glucan multiple interactions ISO Trpm4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TRPM4 mRNA CTD PMID:36331819 Trpm4 Rat 1,2-dimethylhydrazine affects expression ISO Trpm4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of TRPM4 mRNA CTD PMID:22206623 Trpm4 Rat 1,4-dithiothreitol multiple interactions ISO TRPM4 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased expression of TRPM4 protein] CTD PMID:28214884 Trpm4 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO TRPM4 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to TRPM4 protein CTD PMID:32991956 Trpm4 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of TRPM4 mRNA CTD PMID:30723492 Trpm4 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TRPM4 mRNA CTD PMID:32145629 Trpm4 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO TRPM4 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of TRPM4 mRNA CTD PMID:29581250 Trpm4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TRPM4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TRPM4 mRNA CTD PMID:20106945 Trpm4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TRPM4 mRNA CTD PMID:21215274 Trpm4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TRPM4 mRNA CTD PMID:22298810 Trpm4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Trpm4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRPM4 mRNA CTD PMID:19770486 Trpm4 Rat 2,6-dimethoxyphenol multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of TRPM4 protein CTD PMID:38598786 Trpm4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TRPM4 mRNA CTD PMID:21346803 Trpm4 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Trpm4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TRPM4 mRNA CTD PMID:20188158 Trpm4 Rat 4-hydroxy-TEMPO multiple interactions ISO TRPM4 (Homo sapiens) 6480464 tempol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] CTD PMID:31054354 Trpm4 Rat 4-hydroxyphenyl retinamide increases expression ISO Trpm4 (Mus musculus) 6480464 Fenretinide results in increased expression of TRPM4 mRNA CTD PMID:28973697 Trpm4 Rat 5-aza-2'-deoxycytidine multiple interactions ISO TRPM4 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of TRPM4 mRNA] CTD PMID:21095227 Trpm4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TRPM4 mRNA CTD PMID:24780913 and PMID:25825206 Trpm4 Rat 9-phenanthrol multiple interactions ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] more ... CTD PMID:25047048 more ... Trpm4 Rat 9-phenanthrol decreases activity ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol results in decreased activity of TRPM4 protein CTD PMID:34335274 Trpm4 Rat 9-phenanthrol multiple interactions ISO Trpm4 (Mus musculus) 6480464 9-phenanthrol inhibits the reaction [Glutamic Acid results in increased activity of TRPM4 protein] CTD PMID:25047048 Trpm4 Rat acetylsalicylic acid increases expression ISO TRPM4 (Homo sapiens) 6480464 Aspirin results in increased expression of TRPM4 mRNA CTD PMID:11906190 Trpm4 Rat aflatoxin B1 decreases expression ISO Trpm4 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TRPM4 mRNA CTD PMID:19770486 Trpm4 Rat aflatoxin B1 increases methylation ISO TRPM4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TRPM4 intron CTD PMID:30157460 Trpm4 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of TRPM4 mRNA CTD PMID:23630614 and PMID:25378103 Trpm4 Rat Aflatoxin B2 alpha increases methylation ISO TRPM4 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of TRPM4 intron CTD PMID:30157460 Trpm4 Rat aldosterone increases expression ISO TRPM4 (Homo sapiens) 6480464 Aldosterone results in increased expression of TRPM4 protein CTD PMID:28214884 Trpm4 Rat all-trans-retinoic acid increases expression ISO TRPM4 (Homo sapiens) 6480464 Tretinoin results in increased expression of TRPM4 mRNA CTD PMID:33167477 Trpm4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TRPM4 mRNA CTD PMID:16483693 Trpm4 Rat aristolochic acid A increases expression ISO TRPM4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TRPM4 mRNA CTD PMID:33212167 Trpm4 Rat arsenous acid increases expression ISO TRPM4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TRPM4 mRNA and Arsenic Trioxide results in increased expression of TRPM4 protein CTD PMID:31054354 Trpm4 Rat arsenous acid multiple interactions ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] and tempol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] CTD PMID:31054354 Trpm4 Rat ATP decreases activity ISO Trpm4 (Mus musculus) 6480464 Adenosine Triphosphate results in decreased activity of TRPM4 protein CTD PMID:17188667 Trpm4 Rat ATP decreases activity EXP 6480464 Adenosine Triphosphate results in decreased activity of TRPM4 protein CTD PMID:16966582 Trpm4 Rat atrazine increases expression ISO TRPM4 (Homo sapiens) 6480464 Atrazine results in increased expression of TRPM4 mRNA CTD PMID:22378314 Trpm4 Rat Azoxymethane multiple interactions ISO Trpm4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TRPM4 mRNA CTD PMID:29950665 Trpm4 Rat benzo[a]pyrene decreases expression ISO Trpm4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TRPM4 mRNA CTD PMID:19770486 Trpm4 Rat benzo[e]pyrene increases methylation ISO TRPM4 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TRPM4 intron CTD PMID:30157460 Trpm4 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of TRPM4 mRNA CTD PMID:32533902 Trpm4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRPM4 mRNA CTD PMID:25181051 Trpm4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TRPM4 mRNA CTD PMID:32145629 Trpm4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TRPM4 mRNA CTD PMID:29097150 more ... Trpm4 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of TRPM4 mRNA CTD PMID:19167457 Trpm4 Rat cadmium dichloride increases expression ISO TRPM4 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TRPM4 mRNA CTD PMID:38568856 Trpm4 Rat calcium atom multiple interactions EXP 6480464 Calcium binds to and results in increased activity of TRPM4 protein CTD PMID:16966582 Trpm4 Rat calcium atom multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Ionomycin co-treated with Calcium co-treated with CAMK2D protein] results in increased activity of TRPM4 protein CTD PMID:33392831 Trpm4 Rat calcium atom increases activity ISO Trpm4 (Mus musculus) 6480464 Calcium results in increased activity of TRPM4 protein CTD PMID:17188667 Trpm4 Rat calcium(0) multiple interactions EXP 6480464 Calcium binds to and results in increased activity of TRPM4 protein CTD PMID:16966582 Trpm4 Rat calcium(0) multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Ionomycin co-treated with Calcium co-treated with CAMK2D protein] results in increased activity of TRPM4 protein CTD PMID:33392831 Trpm4 Rat calcium(0) increases activity ISO Trpm4 (Mus musculus) 6480464 Calcium results in increased activity of TRPM4 protein CTD PMID:17188667 Trpm4 Rat chlordecone increases expression ISO Trpm4 (Mus musculus) 6480464 Chlordecone results in increased expression of TRPM4 mRNA CTD PMID:29980752 Trpm4 Rat choline multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of TRPM4 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TRPM4 mRNA CTD PMID:20938992 and PMID:29127188 Trpm4 Rat chromium(6+) affects expression ISO Trpm4 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of TRPM4 mRNA CTD PMID:28472532 Trpm4 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TRPM4 mRNA CTD PMID:17602206 Trpm4 Rat cyclosporin A decreases expression ISO Trpm4 (Mus musculus) 6480464 Cyclosporine results in decreased expression of TRPM4 mRNA CTD PMID:19770486 Trpm4 Rat dextran sulfate multiple interactions ISO Trpm4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TRPM4 mRNA CTD PMID:29950665 Trpm4 Rat diarsenic trioxide increases expression ISO TRPM4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TRPM4 mRNA and Arsenic Trioxide results in increased expression of TRPM4 protein CTD PMID:31054354 Trpm4 Rat diarsenic trioxide multiple interactions ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] and tempol inhibits the reaction [Arsenic Trioxide results in increased expression of TRPM4 protein] CTD PMID:31054354 Trpm4 Rat diazinon increases methylation ISO TRPM4 (Homo sapiens) 6480464 Diazinon results in increased methylation of TRPM4 gene CTD PMID:22964155 Trpm4 Rat dichloroacetic acid increases expression ISO Trpm4 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of TRPM4 mRNA CTD PMID:28962523 Trpm4 Rat Dichloroacetonitrile affects response to substance ISO TRPM4 (Homo sapiens) 6480464 TRPM4 gene SNP affects the susceptibility to dichloroacetonitrile CTD PMID:25622337 Trpm4 Rat dorsomorphin multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TRPM4 mRNA CTD PMID:27188386 Trpm4 Rat doxorubicin decreases expression ISO TRPM4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TRPM4 mRNA CTD PMID:29803840 Trpm4 Rat entinostat increases expression ISO TRPM4 (Homo sapiens) 6480464 entinostat results in increased expression of TRPM4 mRNA CTD PMID:27188386 Trpm4 Rat ethanol affects expression ISO Trpm4 (Mus musculus) 6480464 Ethanol affects the expression of TRPM4 mRNA CTD PMID:30319688 Trpm4 Rat flufenamic acid decreases activity ISO Trpm4 (Mus musculus) 6480464 Flufenamic Acid results in decreased activity of TRPM4 protein CTD PMID:17188667 Trpm4 Rat flufenamic acid decreases activity EXP 6480464 Flufenamic Acid results in decreased activity of TRPM4 protein CTD PMID:16966582 Trpm4 Rat folic acid multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of TRPM4 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TRPM4 mRNA CTD PMID:20938992 and PMID:29127188 Trpm4 Rat furan increases expression EXP 6480464 furan results in increased expression of TRPM4 mRNA CTD PMID:25539665 Trpm4 Rat furfural multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TRPM4 protein CTD PMID:38598786 Trpm4 Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of TRPM4 mRNA CTD PMID:32533902 Trpm4 Rat glyburide decreases activity EXP 6480464 Glyburide results in decreased activity of TRPM4 protein CTD PMID:16966582 Trpm4 Rat glyburide decreases activity ISO Trpm4 (Mus musculus) 6480464 Glyburide results in decreased activity of TRPM4 protein CTD PMID:17188667 Trpm4 Rat hydrogen peroxide increases expression ISO TRPM4 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of TRPM4 protein CTD PMID:28214884 Trpm4 Rat hydrogen peroxide multiple interactions ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol inhibits the reaction [Hydrogen Peroxide results in increased expression of TRPM4 protein] and Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased expression of TRPM4 protein] CTD PMID:28214884 Trpm4 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of TRPM4 mRNA CTD PMID:21396975 Trpm4 Rat inulin multiple interactions ISO Trpm4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TRPM4 mRNA CTD PMID:36331819 Trpm4 Rat ionomycin multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Ionomycin co-treated with Calcium co-treated with CAMK2D protein] results in increased activity of TRPM4 protein CTD PMID:33392831 Trpm4 Rat ionomycin increases activity ISO TRPM4 (Homo sapiens) 6480464 Ionomycin results in increased activity of TRPM4 protein CTD PMID:25047048 Trpm4 Rat ivermectin decreases expression ISO TRPM4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TRPM4 protein CTD PMID:32959892 Trpm4 Rat L-1,4-dithiothreitol multiple interactions ISO TRPM4 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in increased expression of TRPM4 protein] CTD PMID:28214884 Trpm4 Rat L-glutamic acid increases activity ISO Trpm4 (Mus musculus) 6480464 Glutamic Acid results in increased activity of TRPM4 protein CTD PMID:25047048 Trpm4 Rat L-glutamic acid multiple interactions ISO Trpm4 (Mus musculus) 6480464 9-phenanthrol inhibits the reaction [Glutamic Acid results in increased activity of TRPM4 protein] and YWHAG protein affects the reaction [Glutamic Acid results in increased activity of TRPM4 protein] CTD PMID:25047048 Trpm4 Rat L-glutamic acid multiple interactions ISO TRPM4 (Homo sapiens) 6480464 9-phenanthrol inhibits the reaction [Glutamic Acid results in increased activity of TRPM4 protein] CTD PMID:25047048 Trpm4 Rat L-glutamic acid increases activity ISO TRPM4 (Homo sapiens) 6480464 Glutamic Acid results in increased activity of TRPM4 protein CTD PMID:25047048 Trpm4 Rat L-methionine multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of TRPM4 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TRPM4 mRNA CTD PMID:20938992 and PMID:29127188 Trpm4 Rat leflunomide increases expression ISO TRPM4 (Homo sapiens) 6480464 leflunomide results in increased expression of TRPM4 mRNA CTD PMID:28988120 Trpm4 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of TRPM4 mRNA and Lipopolysaccharides results in increased expression of TRPM4 protein CTD PMID:27246103 Trpm4 Rat lipopolysaccharide multiple interactions ISO Trpm4 (Mus musculus) 6480464 Lipopolysaccharides promotes the reaction [ABCC8 protein binds to TRPM4 protein] more ... CTD PMID:27246103 Trpm4 Rat manganese atom increases expression ISO TRPM4 (Homo sapiens) 6480464 Manganese results in increased expression of TRPM4 mRNA CTD PMID:17175027 Trpm4 Rat manganese(0) increases expression ISO TRPM4 (Homo sapiens) 6480464 Manganese results in increased expression of TRPM4 mRNA CTD PMID:17175027 Trpm4 Rat manganese(II) chloride increases expression ISO TRPM4 (Homo sapiens) 6480464 manganese chloride results in increased expression of TRPM4 mRNA CTD PMID:17175027 Trpm4 Rat methapyrilene increases methylation ISO TRPM4 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TRPM4 intron CTD PMID:30157460 Trpm4 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Trpm4 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of TRPM4 gene CTD PMID:27776689 Trpm4 Rat N-methyl-4-phenylpyridinium increases expression ISO TRPM4 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TRPM4 mRNA CTD PMID:24810058 Trpm4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TRPM4 mRNA CTD PMID:17602206 Trpm4 Rat N-nitrosodiethylamine multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of TRPM4 gene CTD PMID:23968726 Trpm4 Rat N-nitrosodiethylamine increases expression ISO Trpm4 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of TRPM4 mRNA CTD PMID:24535843 Trpm4 Rat niclosamide increases expression ISO TRPM4 (Homo sapiens) 6480464 Niclosamide results in increased expression of TRPM4 mRNA CTD PMID:36318118 Trpm4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TRPM4 mRNA CTD PMID:33387578 Trpm4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Trpm4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TRPM4 mRNA more ... CTD PMID:36331819 Trpm4 Rat perfluorooctanoic acid increases expression ISO Trpm4 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of TRPM4 mRNA CTD PMID:30711707 Trpm4 Rat phenylmercury acetate decreases expression ISO TRPM4 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of TRPM4 mRNA CTD PMID:26272509 Trpm4 Rat phenylmercury acetate multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TRPM4 mRNA CTD PMID:27188386 Trpm4 Rat piperonyl butoxide multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of TRPM4 gene CTD PMID:23968726 Trpm4 Rat pirinixic acid increases expression ISO Trpm4 (Mus musculus) 6480464 pirinixic acid results in increased expression of TRPM4 mRNA CTD PMID:18301758 more ... Trpm4 Rat potassium atom increases transport ISO Trpm4 (Mus musculus) 6480464 TRPM4 protein results in increased transport of Potassium CTD PMID:17188667 Trpm4 Rat potassium atom increases transport EXP 6480464 TRPM4 protein results in increased transport of Potassium CTD PMID:16966582 Trpm4 Rat progesterone decreases expression ISO TRPM4 (Homo sapiens) 6480464 Progesterone results in decreased expression of TRPM4 mRNA CTD PMID:21540246 Trpm4 Rat resveratrol multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TRPM4 mRNA CTD PMID:23557933 Trpm4 Rat SB 431542 multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TRPM4 mRNA CTD PMID:27188386 Trpm4 Rat silicon dioxide decreases expression ISO TRPM4 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of TRPM4 mRNA CTD PMID:25895662 Trpm4 Rat sodium arsenite multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [sodium arsenite affects the acetylation of H3-4 protein] which affects the methylation of TRPM4 promoter CTD PMID:18448484 Trpm4 Rat sodium arsenite increases expression ISO TRPM4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TRPM4 mRNA CTD PMID:34032870 and PMID:38568856 Trpm4 Rat sodium atom increases transport EXP 6480464 TRPM4 protein results in increased transport of Sodium CTD PMID:16966582 Trpm4 Rat sodium atom increases transport ISO Trpm4 (Mus musculus) 6480464 TRPM4 protein results in increased transport of Sodium CTD PMID:17188667 Trpm4 Rat sodium chloride multiple interactions ISO TRPM4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TRPM4 protein more ... CTD PMID:38598786 Trpm4 Rat streptozocin multiple interactions ISO Trpm4 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of TRPM4 mRNA CTD PMID:29127188 Trpm4 Rat testosterone increases expression ISO TRPM4 (Homo sapiens) 6480464 Testosterone results in increased expression of TRPM4 mRNA CTD PMID:33359661 Trpm4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TRPM4 mRNA] CTD PMID:31150632 Trpm4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TRPM4 mRNA CTD PMID:31150632 Trpm4 Rat titanium dioxide multiple interactions ISO Trpm4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of TRPM4 mRNA CTD PMID:29950665 Trpm4 Rat titanium dioxide increases methylation ISO Trpm4 (Mus musculus) 6480464 titanium dioxide results in increased methylation of TRPM4 gene CTD PMID:35295148 Trpm4 Rat tributylstannane increases expression ISO Trpm4 (Mus musculus) 6480464 tributyltin results in increased expression of TRPM4 mRNA CTD PMID:31939706 Trpm4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TRPM4 mRNA CTD PMID:33387578 Trpm4 Rat triclosan decreases expression ISO TRPM4 (Homo sapiens) 6480464 Triclosan results in decreased expression of TRPM4 mRNA CTD PMID:30510588 Trpm4 Rat triphenyl phosphate affects expression ISO TRPM4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TRPM4 mRNA CTD PMID:37042841 Trpm4 Rat tris(2-butoxyethyl) phosphate affects expression ISO TRPM4 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of TRPM4 mRNA CTD PMID:29024780 Trpm4 Rat urethane increases expression ISO TRPM4 (Homo sapiens) 6480464 Urethane results in increased expression of TRPM4 mRNA CTD PMID:28818685 Trpm4 Rat valproic acid affects expression ISO TRPM4 (Homo sapiens) 6480464 Valproic Acid affects the expression of TRPM4 mRNA CTD PMID:25979313 Trpm4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of TRPM4 mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,4-dithiothreitol (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4-hydroxy-TEMPO (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 9-phenanthrol (ISO) acetylsalicylic acid (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) aldosterone (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) ATP (EXP,ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) chlordecone (ISO) choline (ISO) chromium(6+) (ISO) clofibric acid (EXP) cyclosporin A (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (ISO) dichloroacetic acid (ISO) Dichloroacetonitrile (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) flufenamic acid (EXP,ISO) folic acid (ISO) furan (EXP) furfural (ISO) genistein (EXP) glyburide (EXP,ISO) hydrogen peroxide (ISO) indole-3-methanol (EXP) inulin (ISO) ionomycin (ISO) ivermectin (ISO) L-1,4-dithiothreitol (ISO) L-glutamic acid (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (EXP,ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) niclosamide (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) potassium atom (EXP,ISO) progesterone (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium atom (EXP,ISO) sodium chloride (ISO) streptozocin (ISO) testosterone (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
adaptive immune response (IEA) calcium ion transmembrane transport (IEA) calcium ion transport (IEA,ISO) calcium-mediated signaling (IEA,ISO) cellular response to ATP (IEA,ISO) dendritic cell chemotaxis (IEA,ISO,ISS) immune system process (IEA) inorganic cation transmembrane transport (IEA,ISO,ISS) long-term memory (IMP) membrane depolarization during AV node cell action potential (IEA,ISO) membrane depolarization during bundle of His cell action potential (IEA,ISO) membrane depolarization during Purkinje myocyte cell action potential (IEA,ISO) metal ion transport (IBA) monoatomic cation transmembrane transport (IBA,IEA) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) negative regulation of bone mineralization (IMP) negative regulation of osteoblast differentiation (IMP) positive regulation of adipose tissue development (IMP) positive regulation of atrial cardiac muscle cell action potential (IMP) positive regulation of canonical Wnt signaling pathway (IEA,ISO,ISS) positive regulation of cell population proliferation (IEA,ISO,ISS) positive regulation of cytosolic calcium ion concentration (IMP) positive regulation of fat cell differentiation (IMP) positive regulation of heart rate (IMP) positive regulation of insulin secretion involved in cellular response to glucose stimulus (IMP) positive regulation of regulation of vascular associated smooth muscle cell membrane depolarization (IMP) positive regulation of vasoconstriction (IMP) protein homotetramerization (IEA,ISO,ISS) protein sumoylation (IEA,ISO,ISS) regulation of heart rate by cardiac conduction (IEA,ISO) regulation of T cell cytokine production (IEA,ISO,ISS) regulation of ventricular cardiac muscle cell action potential (IEA,ISO) sodium ion import across plasma membrane (IEA,ISO) transmembrane transport (IEA)
Cellular Component
endoplasmic reticulum (IDA,IEA,ISO) Golgi apparatus (IDA,IEA,ISO) membrane (IEA,ISO) neuronal cell body (IDA) nucleoplasm (IEA,ISO) plasma membrane (IBA,IDA,IEA,ISO,ISS) sodium channel complex (IEA,ISO)
1.
Disentangling the role of TRPM4 in hippocampus-dependent plasticity and learning: an electrophysiological, behavioral and FMRI approach.
Bovet-Carmona M, etal., Brain Struct Funct. 2018 Nov;223(8):3557-3576. doi: 10.1007/s00429-018-1706-1. Epub 2018 Jul 3.
2.
TRPM4 controls insulin secretion in pancreatic beta-cells.
Cheng H, etal., Cell Calcium. 2007 Jan;41(1):51-61. Epub 2006 Jun 27.
3.
Vasoconstriction resulting from dynamic membrane trafficking of TRPM4 in vascular smooth muscle cells.
Crnich R, etal., Am J Physiol Cell Physiol. 2010 Sep;299(3):C682-94. doi: 10.1152/ajpcell.00101.2010. Epub 2010 Jul 7.
4.
Critical role for transient receptor potential channel TRPM4 in myogenic constriction of cerebral arteries.
Earley S, etal., Circ Res. 2004 Oct 29;95(9):922-9. Epub 2004 Oct 7.
5.
Basal protein kinase Cdelta activity is required for membrane localization and activity of TRPM4 channels in cerebral artery smooth muscle cells.
Garcia ZI, etal., Channels (Austin). 2011 May-Jun;5(3):210-4. Epub 2011 May 1.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
De novo expression of Trpm4 initiates secondary hemorrhage in spinal cord injury.
Gerzanich V, etal., Nat Med. 2009 Feb;15(2):185-91. doi: 10.1038/nm.1899. Epub 2009 Jan 25.
8.
Pharmacological inhibition of TRPM4 hyperpolarizes vascular smooth muscle.
Gonzales AL, etal., Am J Physiol Cell Physiol. 2010 Nov;299(5):C1195-202. doi: 10.1152/ajpcell.00269.2010. Epub 2010 Sep 8.
9.
Functional expression of the TRPM4 cationic current in ventricular cardiomyocytes from spontaneously hypertensive rats.
Guinamard R, etal., Hypertension. 2006 Oct;48(4):587-94. Epub 2006 Sep 11.
10.
Implication of the TRPM4 nonselective cation channel in mammalian sinus rhythm.
Hof T, etal., Heart Rhythm. 2013 Nov;10(11):1683-9. doi: 10.1016/j.hrthm.2013.08.014. Epub 2013 Aug 14.
11.
Glibenclamide Improves Survival and Neurologic Outcome After Cardiac Arrest in Rats.
Huang K, etal., Crit Care Med. 2015 Sep;43(9):e341-9. doi: 10.1097/CCM.0000000000001093.
12.
17ß-estradiol inhibits MMP-9 and SUR1/TrpM4 expression and activation and thereby attenuates BSCB disruption/hemorrhage after spinal cord injury in male rats.
Lee JY, etal., Endocrinology. 2015 May;156(5):1838-50. doi: 10.1210/en.2014-1832. Epub 2015 Mar 12.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Identification and characterization of the murine TRPM4 channel.
Murakami M, etal., Biochem Biophys Res Commun 2003 Aug 1;307(3):522-8.
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
Transient receptor potential melastatin 4 channel controls calcium signals and dental follicle stem cell differentiation.
Nelson P, etal., Stem Cells. 2013 Jan;31(1):167-77. doi: 10.1002/stem.1264.
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Information Derived from GenBank Report
RGD, Sept. 2003
22.
Transient receptor potential channel m4 and m5 in magnocellular cells in rat supraoptic and paraventricular nuclei.
Teruyama R, etal., J Neuroendocrinol. 2011 Dec;23(12):1204-13. doi: 10.1111/j.1365-2826.2011.02211.x.
23.
Inhibition of the Sur1-Trpm4 channel reduces neuroinflammation and cognitive impairment in subarachnoid hemorrhage.
Tosun C, etal., Stroke. 2013 Dec;44(12):3522-8. doi: 10.1161/STROKEAHA.113.002904. Epub 2013 Oct 10.
24.
Cloning and characterization of rat transient receptor potential-melastatin 4 (TRPM4).
Yoo JC, etal., Biochem Biophys Res Commun. 2010 Jan 1;391(1):806-11. doi: 10.1016/j.bbrc.2009.11.142. Epub 2009 Nov 27.
Trpm4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,918,462 - 104,949,453 (-) NCBI GRCr8 mRatBN7.2 1 95,781,805 - 95,812,095 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,782,000 - 95,812,532 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,167,413 - 101,197,191 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,640,086 - 109,669,864 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,930,482 - 102,960,268 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,293,300 - 101,323,484 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,293,409 - 101,323,960 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,357,043 - 102,387,010 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,773,485 - 95,803,542 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,851,812 - 95,863,602 (-) NCBI Celera 1 90,039,848 - 90,063,911 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
TRPM4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 49,157,792 - 49,211,836 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 49,157,741 - 49,211,836 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 49,661,049 - 49,715,093 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 54,352,864 - 54,406,905 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 54,352,863 - 54,406,903 NCBI Celera 19 46,527,963 - 46,581,978 (+) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 46,037,071 - 46,092,109 (+) NCBI HuRef CHM1_1 19 49,662,673 - 49,716,555 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 52,152,347 - 52,209,191 (+) NCBI T2T-CHM13v2.0
Trpm4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 44,952,579 - 44,983,495 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 44,952,056 - 44,983,204 (-) Ensembl GRCm39 Ensembl GRCm38 7 45,303,155 - 45,334,071 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 45,302,632 - 45,333,780 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 52,558,525 - 52,589,150 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 45,170,674 - 45,201,784 (-) NCBI MGSCv36 mm8 Celera 7 40,759,067 - 40,790,038 (-) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 29.24 NCBI
Trpm4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 1,546,365 - 1,581,712 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 1,539,036 - 1,581,800 (-) NCBI ChiLan1.0 ChiLan1.0
TRPM4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 55,272,183 - 55,328,155 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 57,191,713 - 57,248,153 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 46,168,301 - 46,224,726 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 55,095,029 - 55,150,464 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 55,095,029 - 55,150,464 (+) Ensembl panpan1.1 panPan2
TRPM4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 107,261,760 - 107,304,157 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 107,261,756 - 107,303,346 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 106,849,462 - 106,891,183 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 107,786,342 - 107,828,325 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 107,678,345 - 107,828,249 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 107,454,730 - 107,496,450 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 107,100,989 - 107,142,706 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 107,938,110 - 107,978,274 (-) NCBI UU_Cfam_GSD_1.0
Trpm4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 21,474,889 - 21,506,283 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936664 3,093,367 - 3,124,117 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936664 3,093,258 - 3,124,473 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TRPM4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 54,342,784 - 54,377,155 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 54,342,774 - 54,377,557 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 49,975,735 - 49,985,615 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRPM4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 42,379,534 - 42,424,721 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 42,379,659 - 42,424,146 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 22,272,664 - 22,341,345 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trpm4
.
Predicted Target Of
Count of predictions: 463 Count of miRNA genes: 232 Interacting mature miRNAs: 276 Transcripts: ENSRNOT00000041513 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH133941
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,803,951 - 95,804,147 (+) MAPPER mRatBN7.2 Rnor_6.0 1 101,315,365 - 101,315,560 NCBI Rnor6.0 Rnor_5.0 1 102,378,888 - 102,379,083 UniSTS Rnor5.0 RGSC_v3.4 1 95,795,720 - 95,795,915 UniSTS RGSC3.4 Celera 1 90,061,722 - 90,061,917 UniSTS RH 3.4 Map 1 910.1 UniSTS Cytogenetic Map 1 q22 UniSTS
AI234615
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,782,252 - 95,782,461 (+) MAPPER mRatBN7.2 Rnor_6.0 1 101,293,553 - 101,293,761 NCBI Rnor6.0 Rnor_5.0 1 102,357,296 - 102,357,504 UniSTS Rnor5.0 RGSC_v3.4 1 95,773,738 - 95,773,946 UniSTS RGSC3.4 Celera 1 90,040,101 - 90,040,309 UniSTS RH 3.4 Map 1 908.89 UniSTS Cytogenetic Map 1 q22 UniSTS
Trpm4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,782,428 - 95,782,510 (+) MAPPER mRatBN7.2 Rnor_6.0 1 101,293,729 - 101,293,810 NCBI Rnor6.0 Rnor_5.0 1 102,357,472 - 102,357,553 UniSTS Rnor5.0 Celera 1 90,040,277 - 90,040,358 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041513 ⟹ ENSRNOP00000041387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,782,000 - 95,812,532 (-) Ensembl Rnor_6.0 Ensembl 1 101,293,409 - 101,323,960 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099429 ⟹ ENSRNOP00000082333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,782,211 - 95,812,532 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100339 ⟹ ENSRNOP00000089776
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,782,211 - 95,812,532 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107811 ⟹ ENSRNOP00000082706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,782,723 - 95,812,532 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113541 ⟹ ENSRNOP00000090318
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,782,000 - 95,811,382 (-) Ensembl
RefSeq Acc Id:
NM_001136229 ⟹ NP_001129701
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,918,462 - 104,948,236 (-) NCBI mRatBN7.2 1 95,782,000 - 95,811,746 (-) NCBI Rnor_6.0 1 101,293,300 - 101,323,187 (-) NCBI Rnor_5.0 1 102,357,043 - 102,387,010 (-) NCBI RGSC_v3.4 1 95,773,485 - 95,803,542 (-) RGD Celera 1 90,039,848 - 90,063,911 (-) RGD
Sequence:
GGCGGCTGAGAGAAATACACGGAGCCCCAGGGGCTGCGACGGCAGCATGGTGGGGCAGGAGAAAGAGCAGAGTTGGATCCCTAAGATCTTCAGGAAGAAGGTGTGCACGACGTTCATAGTGGACCTCC
hide sequence
RefSeq Acc Id:
XM_039088263 ⟹ XP_038944191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,925,950 - 104,949,453 (-) NCBI mRatBN7.2 1 95,789,489 - 95,812,095 (-) NCBI
RefSeq Acc Id:
XR_001835352
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,918,672 - 104,949,431 (-) NCBI mRatBN7.2 1 95,781,805 - 95,812,094 (-) NCBI Rnor_6.0 1 101,293,513 - 101,323,484 (-) NCBI
Sequence:
GTCCCTCTCTTAGTTTCTGTCTCTGCCTCTTTTTGGGTCTTTCTCTCAGTCTCCGCCTCTCAGAATCTATGTTTGTCCCATGGCTGATATCTATCGTGTGCCCTACTCTGCTTCCTTCGTTTCTCTGC
hide sequence
RefSeq Acc Id:
XR_005491008
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,918,672 - 104,948,244 (-) NCBI mRatBN7.2 1 95,781,805 - 95,811,754 (-) NCBI
RefSeq Acc Id:
XR_005491011
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,918,672 - 104,942,567 (-) NCBI mRatBN7.2 1 95,781,805 - 95,806,104 (-) NCBI
RefSeq Acc Id:
XR_005491013
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,923,746 - 104,949,441 (-) NCBI mRatBN7.2 1 95,787,280 - 95,812,094 (-) NCBI
RefSeq Acc Id:
XR_005491016
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,918,672 - 104,937,066 (-) NCBI mRatBN7.2 1 95,781,805 - 95,800,604 (-) NCBI
RefSeq Acc Id:
NP_001129701 ⟸ NM_001136229
- UniProtKB:
Q9ESQ5 (UniProtKB/Swiss-Prot), A0A0H2UHX0 (UniProtKB/TrEMBL)
- Sequence:
MVGQEKEQSWIPKIFRKKVCTTFIVDLHDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLDFTYSGRKSSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSEG
hide sequence
Ensembl Acc Id:
ENSRNOP00000041387 ⟸ ENSRNOT00000041513
RefSeq Acc Id:
XP_038944191 ⟸ XM_039088263
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000082706 ⟸ ENSRNOT00000107811
Ensembl Acc Id:
ENSRNOP00000089776 ⟸ ENSRNOT00000100339
Ensembl Acc Id:
ENSRNOP00000082333 ⟸ ENSRNOT00000099429
Ensembl Acc Id:
ENSRNOP00000090318 ⟸ ENSRNOT00000113541
RGD ID: 13690033 Promoter ID: EPDNEW_R558 Type: single initiation site Name: Trpm4_1 Description: transient receptor potential cation channel, subfamily M, member4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 101,323,972 - 101,324,032 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Trpm4
transient receptor potential cation channel, subfamily M, member 4
Mls2s
melastatin like 2 protein
Symbol and Name updated
1299863 APPROVED
2002-08-07
Mls2s
melastatin like 2 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
