Symbol:
Nos1ap
Name:
nitric oxide synthase 1 adaptor protein
RGD ID:
620106
Description:
Enables PDZ domain binding activity; enzyme binding activity; and signaling adaptor activity. Involved in neuron projection regeneration; regulation of calcium ion transmembrane transport via high voltage-gated calcium channel; and regulation of cardiac muscle cell action potential. Located in cytosol and nuclear membrane. Is active in glutamatergic synapse; postsynapse; and presynapse. Used to study depressive disorder. Biomarker of congestive heart failure and sciatic neuropathy. Human ortholog(s) of this gene implicated in nephrotic syndrome type 22. Orthologous to human NOS1AP (nitric oxide synthase 1 adaptor protein); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; all-trans-retinoic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C--terminal PDZ ligand of neuronal nitric oxide synthase protein; C-terminal PDZ domain ligand of neuronal nitric oxide synthase; C-terminal PDZ ligand of neuronal nitric oxide synthase protein; Capon; carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein; nitric oxide synthase 1 (neuronal) adaptor protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 85,080,558 - 85,353,741 (-) NCBI GRCr8 mRatBN7.2 13 82,547,799 - 82,820,999 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 82,530,577 - 82,820,949 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 85,176,752 - 85,447,913 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 86,470,390 - 86,741,554 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 83,701,983 - 83,973,150 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 88,653,123 - 88,943,976 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 13 93,279,049 - 93,562,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 86,159,295 - 86,432,815 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 86,173,482 - 86,447,003 (-) NCBI Celera 13 82,208,348 - 82,478,185 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
NOS1AP regulates dendrite patterning of hippocampal neurons through a carboxypeptidase E-mediated pathway.
Carrel D, etal., J Neurosci. 2009 Jun 24;29(25):8248-58.
2.
Changes in mRNA for post-synaptic density-95 (PSD-95) and carboxy-terminal PDZ ligand of neuronal nitric oxide synthase following facial nerve transection.
Che YH, etal., Brain Res Mol Brain Res. 2000 Mar 29;76(2):325-35.
3.
Elevated expression of CAPON and neuronal nitric oxide synthase in the sciatic nerve of rats following constriction injury.
Cui Z, etal., Vet J. 2011 Mar;187(3):374-80. Epub 2010 Mar 3.
4.
Dexras1: a G protein specifically coupled to neuronal nitric oxide synthase via CAPON.
Fang M, etal., Neuron 2000 Oct;28(1):183-93.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Human embryonic stem cell-derived neurons as a tool for studying neuroprotection and neurodegeneration.
Hardingham GE, etal., Mol Neurobiol. 2010 Aug;42(1):97-102. doi: 10.1007/s12035-010-8136-2. Epub 2010 Apr 30.
7.
CAPON: a protein associated with neuronal nitric oxide synthase that regulates its interactions with PSD95.
Jaffrey SR, etal., Neuron 1998 Jan;20(1):115-24.
8.
Neuronal nitric-oxide synthase localization mediated by a ternary complex with synapsin and CAPON.
Jaffrey SR, etal., Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):3199-204. Epub 2002 Feb 26.
9.
Inhibition of nitric oxide-induced nuclear localization of CAPON by NMDA receptor antagonist in cultured rat primary astrocytes.
Jiang J, etal., Neurochem Int. 2010 Mar;56(4):561-8. doi: 10.1016/j.neuint.2009.12.019. Epub 2010 Jan 11.
10.
The nNOS-p38MAPK pathway is mediated by NOS1AP during neuronal death.
Li LL, etal., J Neurosci. 2013 May 8;33(19):8185-201. doi: 10.1523/JNEUROSCI.4578-12.2013.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Some molecular effectors of antidepressant action of quetiapine revealed by DNA microarray in the frontal cortex of anhedonic rats.
Orsetti M, etal., Pharmacogenet Genomics. 2009 Aug;19(8):600-12. doi: 10.1097/FPC.0b013e32832ee573.
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
NOS1AP associates with Scribble and regulates dendritic spine development.
Richier L, etal., J Neurosci. 2010 Mar 31;30(13):4796-805. doi: 10.1523/JNEUROSCI.3726-09.2010.
16.
Decreased nNOS in the PVN leads to increased sympathoexcitation in chronic heart failure: role for CAPON and Ang II.
Sharma NM, etal., Cardiovasc Res. 2011 Nov 1;92(2):348-57. doi: 10.1093/cvr/cvr217. Epub 2011 Aug 10.
17.
Changes in mRNA for CAPON and Dexras1 in adult rat following sciatic nerve transection.
Shen A, etal., J Chem Neuroanat. 2008 Jan;35(1):85-93. Epub 2007 Jul 31.
18.
NOS1AP modulates intracellular Ca(2+) in cardiac myocytes and is up-regulated in dystrophic cardiomyopathy.
Treuer AV and Gonzalez DR, Int J Physiol Pathophysiol Pharmacol. 2014 Mar 13;6(1):37-46. eCollection 2014.
Nos1ap Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 85,080,558 - 85,353,741 (-) NCBI GRCr8 mRatBN7.2 13 82,547,799 - 82,820,999 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 82,530,577 - 82,820,949 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 85,176,752 - 85,447,913 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 86,470,390 - 86,741,554 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 83,701,983 - 83,973,150 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 88,653,123 - 88,943,976 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 13 93,279,049 - 93,562,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 86,159,295 - 86,432,815 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 86,173,482 - 86,447,003 (-) NCBI Celera 13 82,208,348 - 82,478,185 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
NOS1AP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 162,069,691 - 162,370,475 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 162,069,691 - 162,370,475 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 162,039,481 - 162,340,265 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 160,306,205 - 160,604,864 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 135,142,979 - 135,442,880 (+) NCBI Celera Cytogenetic Map 1 q23.3 NCBI HuRef 1 133,284,045 - 133,584,478 (+) NCBI HuRef CHM1_1 1 163,461,578 - 163,761,499 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 161,414,004 - 161,714,449 (+) NCBI T2T-CHM13v2.0
Nos1ap Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 170,143,039 - 170,417,371 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 170,130,237 - 170,417,430 (-) Ensembl GRCm39 Ensembl GRCm38 1 170,315,467 - 170,589,849 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 170,302,668 - 170,589,861 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 172,247,627 - 172,519,980 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 172,155,014 - 172,426,524 (-) NCBI MGSCv36 mm8 Celera 1 172,749,789 - 173,028,224 (-) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 76.84 NCBI
NOS1AP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 20,353,341 - 20,614,684 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 20,390,850 - 20,669,110 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 20,414,911 - 20,698,255 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 20,420,318 - 20,698,578 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 20,389,210 - 20,671,686 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 20,749,633 - 21,025,098 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 21,051,640 - 21,316,255 (-) NCBI UU_Cfam_GSD_1.0
C4H1orf226 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 88,140,953 - 88,471,994 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 88,129,231 - 88,471,741 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 95,859,831 - 95,895,801 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
.
Predicted Target Of
Count of predictions: 122 Count of miRNA genes: 97 Interacting mature miRNAs: 109 Transcripts: ENSRNOT00000032218 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
D13Got59
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,598,007 - 82,598,186 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,701,345 - 88,701,521 NCBI Rnor6.0 Rnor_5.0 13 93,327,271 - 93,327,447 UniSTS Rnor5.0 RGSC_v3.4 13 86,208,055 - 86,208,232 RGD RGSC3.4 RGSC_v3.4 13 86,208,056 - 86,208,232 UniSTS RGSC3.4 RGSC_v3.1 13 86,222,243 - 86,222,420 RGD Celera 13 82,256,411 - 82,256,587 UniSTS Cytogenetic Map 13 q24 UniSTS
RH142695
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,560,237 - 82,560,381 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,663,575 - 88,663,718 NCBI Rnor6.0 Rnor_5.0 13 93,289,501 - 93,289,644 UniSTS Rnor5.0 RGSC_v3.4 13 86,169,747 - 86,169,890 UniSTS RGSC3.4 Celera 13 82,218,800 - 82,218,943 UniSTS RH 3.4 Map 13 545.1 UniSTS Cytogenetic Map 13 q24 UniSTS
BF393830
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 13 86,311,755 - 86,311,912 UniSTS RGSC3.4 Celera 13 82,359,152 - 82,359,309 UniSTS RH 3.4 Map 13 548.3 UniSTS Cytogenetic Map 13 q24 UniSTS
BF399011
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,751,130 - 82,751,324 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,873,994 - 88,874,187 NCBI Rnor6.0 Rnor_5.0 13 93,492,756 - 93,492,949 UniSTS Rnor5.0 RGSC_v3.4 13 86,361,306 - 86,361,499 UniSTS RGSC3.4 Celera 13 82,408,330 - 82,408,523 UniSTS RH 3.4 Map 13 545.9 UniSTS Cytogenetic Map 13 q24 UniSTS
RH138049
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,550,264 - 82,550,399 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,653,602 - 88,653,736 NCBI Rnor6.0 Rnor_5.0 13 93,279,528 - 93,279,662 UniSTS Rnor5.0 RGSC_v3.4 13 86,159,774 - 86,159,908 UniSTS RGSC3.4 Celera 13 82,208,827 - 82,208,961 UniSTS RH 3.4 Map 13 545.1 UniSTS Cytogenetic Map 13 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000032218 ⟹ ENSRNOP00000038197
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 82,530,577 - 82,820,949 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096244 ⟹ ENSRNOP00000090505
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 82,530,587 - 82,743,198 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116023 ⟹ ENSRNOP00000079910
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 82,530,587 - 82,539,774 (-) Ensembl
RefSeq Acc Id:
NM_138922 ⟹ NP_620277
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 85,080,558 - 85,353,741 (-) NCBI mRatBN7.2 13 82,547,799 - 82,820,999 (-) NCBI Rnor_6.0 13 88,653,123 - 88,943,976 (-) NCBI Rnor_5.0 13 93,279,049 - 93,562,008 (-) NCBI RGSC_v3.4 13 86,159,295 - 86,432,815 (-) RGD Celera 13 82,208,348 - 82,478,185 (-) RGD
Sequence:
GGCACGAGCCGGGTCGTGCGCGCCGAGCTCGGGATCCGGCTCCCAGTCTAGCCCCGCTTCGGGCCGTGCGCCCTTTGCTCGGCGTCCGGCTCCGGGGCTCCGCGCCACCCGCTCCCGCCTGCCCGGCC
hide sequence
RefSeq Acc Id:
NP_620277 ⟸ NM_138922
- UniProtKB:
O54960 (UniProtKB/Swiss-Prot)
- Sequence:
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGISFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIA
hide sequence
Ensembl Acc Id:
ENSRNOP00000038197 ⟸ ENSRNOT00000032218
Ensembl Acc Id:
ENSRNOP00000079910 ⟸ ENSRNOT00000116023
Ensembl Acc Id:
ENSRNOP00000090505 ⟸ ENSRNOT00000096244
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-10
Nos1ap
nitric oxide synthase 1 adaptor protein
Nos1ap
nitric oxide synthase 1 (neuronal) adaptor protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Nos1ap
nitric oxide synthase 1 (neuronal) adaptor protein
Capon
C-terminal PDZ domain ligand of neuronal nitric oxide synthase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Capon
C-terminal PDZ domain ligand of neuronal nitric oxide synthase
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Capon
C-terminal PDZ domain ligand of neuronal nitric oxide synthase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_mutations_overexpression
overexpression results in a loss of PSD95/nNOS complexes in transfected cells
632364
