Ninj1 (ninjurin 1) - Rat Genome Database

Name: Ninj1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Ninj1 (ninjurin 1) Rattus norvegicus

Analyze

Symbol:

Ninj1

Name:

ninjurin 1

RGD ID:

3179

Description:

Enables cell adhesion mediator activity. Involved in cell adhesion and positive regulation of angiogenesis. Predicted to be located in filopodium membrane and synaptic membrane. Predicted to be active in extracellular region and plasma membrane. Orthologous to human NINJ1 (ninjurin 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene; 2-methoxyethanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

nerve injury-induced protein 1; Ninjurin; ninjurin-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NINJ1 (ninjurin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ninj1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ninj1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NINJ1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NINJ1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ninj1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NINJ1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NINJ1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ninj1 (ninjurin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ninj1 (ninjurin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NINJ1 (ninjurin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-278o19.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	NijA	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	NijB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Drosophila melanogaster (fruit fly):	NijC	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ninj1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	15,659,208 - 15,668,115 (-)	NCBI		GRCr8
mRatBN7.2	17	15,452,804 - 15,461,684 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	15,452,813 - 15,461,704 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	15,339,900 - 15,348,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	16,944,942 - 16,953,752 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	15,266,672 - 15,275,482 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	15,866,235 - 15,881,284 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	15,866,237 - 15,881,327 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	17,930,052 - 17,945,126 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	21,410,701 - 21,419,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	21,410,700 - 21,419,472 (-)	NCBI
Celera	17	15,182,635 - 15,191,450 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic contact dermatitis (ISO)

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,4-phenylenediamine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-acetamidofluorene (EXP)

2-hydroxypropanoic acid (ISO)

2-methoxyethanol (EXP)

3,4-methylenedioxymethamphetamine (EXP,ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

adefovir pivoxil (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

chlorpromazine (EXP)

chlorpyrifos (EXP)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (EXP,ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (EXP,ISO)

dimethylarsinic acid (EXP)

dioxygen (ISO)

disodium selenite (ISO)

diuron (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

ethyl methanesulfonate (ISO)

fenofibrate (EXP)

flutamide (EXP)

formaldehyde (ISO)

genistein (ISO)

glafenine (EXP)

isoprenaline (ISO)

ketoconazole (ISO)

L-ascorbic acid (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

metformin (EXP)

methapyrilene (EXP,ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

morphine (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

pinostrobin (ISO)

propiconazole (EXP)

rac-lactic acid (ISO)

raloxifene (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

selenium atom (ISO)

Soman (EXP)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA)

cell adhesion (IBA,IDA,ISO)

chemotaxis (ISO)

heterotypic cell-cell adhesion (ISO,ISS)

hyaloid vascular plexus regression (ISO)

inflammatory response (ISO,ISS)

killing of cells of another organism (IEA)

leukocyte chemotaxis involved in inflammatory response (ISO,ISS)

macrophage chemotaxis (ISO)

muscle cell differentiation (ISO,ISS)

pericyte cell migration (ISO)

positive regulation of angiogenesis (IDA,ISO)

positive regulation of cell-matrix adhesion (ISO)

positive regulation of inflammatory response (ISO,ISS)

positive regulation of osteoclast development (ISO)

positive regulation of toll-like receptor 4 signaling pathway (ISO,ISS)

programmed cell death (ISO,ISS)

protein homooligomerization (ISO)

pyroptotic inflammatory response (ISO)

regulation of angiogenesis (ISO)

regulation of monocyte chemotaxis (ISO,ISS)

tissue regeneration (IEA)

Cellular Component

extracellular region (ISO,ISS)

filopodium membrane (ISO)

plasma membrane (ISO,ISS)

synaptic membrane (ISO)

Molecular Function

cell adhesion mediator activity (IDA,ISO)

cell-cell adhesion mediator activity (ISO)

lipopolysaccharide binding (ISO,ISS)

membrane destabilizing activity (ISO,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Ninjurin, a novel adhesion molecule, is induced by nerve injury and promotes axonal growth.	Araki T and Milbrandt J, Neuron 1996 Aug;17(2):353-61.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Ninjurin 1 dodecamer peptide containing the N-terminal adhesion motif (N-NAM) exerts proangiogenic effects in HUVECs and in the postischemic brain.	Kim SW, etal., Sci Rep. 2020 Oct 7;10(1):16656. doi: 10.1038/s41598-020-73340-5.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:19557008	PMID:19595672	PMID:33472215

Genomics

Comparative Map Data

Ninj1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	15,659,208 - 15,668,115 (-)	NCBI		GRCr8
mRatBN7.2	17	15,452,804 - 15,461,684 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	15,452,813 - 15,461,704 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	15,339,900 - 15,348,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	16,944,942 - 16,953,752 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	15,266,672 - 15,275,482 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	15,866,235 - 15,881,284 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	15,866,237 - 15,881,327 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	17,930,052 - 17,945,126 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	21,410,701 - 21,419,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	21,410,700 - 21,419,472 (-)	NCBI
Celera	17	15,182,635 - 15,191,450 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

NINJ1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	93,121,496 - 93,134,251 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	93,121,496 - 93,134,251 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	95,883,778 - 95,896,533 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	94,923,592 - 94,936,391 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	92,963,334 - 92,976,125	NCBI
Celera	9	66,325,478 - 66,338,278 (-)	NCBI		Celera
Cytogenetic Map	9	q22.31	NCBI
HuRef	9	65,560,157 - 65,572,990 (-)	NCBI		HuRef
CHM1_1	9	96,030,378 - 96,043,177 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	105,288,107 - 105,300,864 (-)	NCBI		T2T-CHM13v2.0

Ninj1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	49,341,005 - 49,349,727 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	49,340,961 - 49,349,720 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	49,187,529 - 49,196,251 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	49,187,485 - 49,196,244 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	49,282,916 - 49,291,620 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	49,199,484 - 49,208,188 (+)	NCBI		MGSCv36	mm8
Celera	13	50,277,705 - 50,286,409 (+)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	25.14	NCBI

Ninj1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955515	4,892,039 - 4,907,323 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955515	4,892,748 - 4,905,627 (+)	NCBI	ChiLan1.0	ChiLan1.0

NINJ1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	46,293,062 - 46,306,329 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	46,295,457 - 46,308,713 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	64,245,086 - 64,258,614 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	92,311,502 - 92,324,025 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	92,311,502 - 92,324,030 (-)	Ensembl	panpan1.1		panPan2

NINJ1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	98,566,520 - 98,576,668 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	98,567,680 - 98,576,657 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	98,960,941 - 98,970,738 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	99,183,728 - 99,193,686 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	98,797,064 - 98,806,858 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	98,532,406 - 98,542,206 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	99,288,008 - 99,297,814 (+)	NCBI		UU_Cfam_GSD_1.0

Ninj1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	8,270,364 - 8,275,943 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	2,487,904 - 2,491,827 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	2,486,831 - 2,531,943 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NINJ1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	42,654,228 - 42,672,778 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	42,654,536 - 42,672,830 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NINJ1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	103,509,950 - 103,523,158 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	103,510,454 - 103,523,084 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	91,784,589 - 91,798,519 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ninj1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	3,430,209 - 3,445,542 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624868	3,430,539 - 3,442,205 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ninj1
26 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	80
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000022341
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	17	4299130	21293263	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	13986773	21975515	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15330613	23017269	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat

Markers in Region

RH128424

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	15,452,994 - 15,453,192 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	15,866,419 - 15,866,616	NCBI	Rnor6.0
Rnor_5.0	17	17,930,236 - 17,930,433	UniSTS	Rnor5.0
RGSC_v3.4	17	21,410,885 - 21,411,082	UniSTS	RGSC3.4
Celera	17	15,182,819 - 15,183,016	UniSTS
RH 3.4 Map	17	175.3	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	55	41	17	41		2	63	35	40	11
Low		7	2		2		8	9	11		1		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U72660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022341 ⟹ ENSRNOP00000022341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	15,452,813 - 15,461,704 (-)	Ensembl
Rnor_6.0 Ensembl	17	15,866,237 - 15,881,327 (-)	Ensembl

RefSeq Acc Id:

NM_012867 ⟹ NP_036999

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	15,659,208 - 15,668,031 (-)	NCBI
mRatBN7.2	17	15,452,811 - 15,461,635 (-)	NCBI
Rnor_6.0	17	15,866,235 - 15,881,284 (-)	NCBI
Rnor_5.0	17	17,930,052 - 17,945,126 (-)	NCBI
RGSC_v3.4	17	21,410,701 - 21,419,472 (-)	RGD
Celera	17	15,182,635 - 15,191,450 (-)	RGD

Sequence:

show sequence

CCATGGATCCCGGCACCGAGGAGTACGAGCTCAACGGCGACCTGCGCCCTGGCTCTCCCGGTTC
CCCCGACGCCTCGCCACCCCGCTGGGGTTTGAGGAACCGGCCCATCAATGTAAACCATTACGCC
AACAAGAAGAGCGCCGCGGAGAGCATGCTGGACATCGCACTGCTCATGGCCAACGCGTCGCAGC
TCAAGGCCGTGGTGGAGCAGGGCAATGAGTTCGCCTTCTTCGTGCCCCTCGTGGTGCTCATCTC
CATCTCTCTCGTGCTGCAGATCGGAGTGGGCGTGCTGCTCATCTTCCTGGTCAAGTATGACCTC
AACAACCCAGCCAAGCACGCCAAGCTGGACTTCCTTAACAACCTGGCCACGGGGCTGGTTTTCA
TCATCGTGGTGGTCAACATCTTCATTACGGCCTTTGGAGTCCAGAAGCCTGTCATGGACGTGGC
ACCCCGGCAGTAGGATGCCCAGAGACCTTGAAGGTATCTGACCTGCAGCCCAGCTGTCCAGACC
CCTGCAACTGCTGTATCCCCAAGGCATCCCTCTCCTGTTCACAGCCCAAGGTGGCCTCCGCTGG
ACCATGGTCAAGGATGGACTTCCGTCCACCTGTGACTGCTGCGTGGGCGGCCACCCGAGGCGTG
TGGGAACTGGATGCAAAGCCATGAAGATCAGAACTGGACAGTTCCACCGAAACCCACGCCCAGA
GGATGATCACTGCCCGCCCAAGGACATGCAGGAAATCCATGATTGGACTCGATGAGGGGCCAGA
ACTGATCTCTGTCTCAGGACATTCCAGAAGGACCAGGATATGCCCCTCCCTTTGCTGATACACC
AGTGACCCTACTTCTCATGGAGCATGCACAGGTCACCCTGGAGACTGCTCCCTTTGTTGTTTCC
TGACCCAGGGACCTTGGACAGTCATCAGTACCTGCTGGCTCCAGCCTCAGTGCCTGGGCTTGGC
AGTGTCTCTTGGCATCGAGAGGCAGCCATGCCTGTGGGGGCTGCAGGTCATCCTGGTACCTTCT
ACCAGTAGTGACTTGGGAAGAGCCCCACCCCCCAACCCAGGGGCTCAGGCCCCAATTTTCTAAT
CAGGAATGACAATAAAGCTTATGTCTTCCCCC

hide sequence

RefSeq Acc Id:

XM_063276077 ⟹ XP_063132147

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	15,659,208 - 15,668,115 (-)	NCBI

RefSeq Acc Id:

XM_063276078 ⟹ XP_063132148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	15,659,208 - 15,664,277 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_036999	(Get FASTA)	NCBI Sequence Viewer
	XP_063132147	(Get FASTA)	NCBI Sequence Viewer
	XP_063132148	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB17559	(Get FASTA)	NCBI Sequence Viewer
	EDL98126	(Get FASTA)	NCBI Sequence Viewer
	EDL98127	(Get FASTA)	NCBI Sequence Viewer
	EDL98128	(Get FASTA)	NCBI Sequence Viewer
	EDL98129	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022341
	ENSRNOP00000022341.1
	ENSRNOP00055021154
	ENSRNOP00060029137
	ENSRNOP00065012296
GenBank Protein	P70617	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036999 ⟸ NM_012867
- UniProtKB:	P70617 (UniProtKB/Swiss-Prot), A6J6X6 (UniProtKB/TrEMBL), A6J6X8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDPGTEEYELNGDLRPGSPGSPDASPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQL KAVVEQGNEFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFI IVVVNIFITAFGVQKPVMDVAPRQ hide sequence

RefSeq Acc Id:

ENSRNOP00000022341 ⟸ ENSRNOT00000022341

RefSeq Acc Id:	XP_063132147 ⟸ XM_063276077
- Peptide Label:	isoform X1
- UniProtKB:	P70617 (UniProtKB/Swiss-Prot), A6J6X6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132148 ⟸ XM_063276078
- Peptide Label:	isoform X2
- UniProtKB:	A6J6X9 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70617-F1-model_v2	AlphaFold	P70617	1-152	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700357

Promoter ID:

EPDNEW_R10881

Type:

initiation region

Name:

Ninj1_1

Description:

ninjurin 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	15,881,316 - 15,881,376	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3179	AgrOrtholog
BioCyc Gene	G2FUF-9989	BioCyc
Ensembl Genes	ENSRNOG00000016587	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055015164	UniProtKB/Swiss-Prot
	ENSRNOG00060020471	UniProtKB/Swiss-Prot
	ENSRNOG00065010091	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022341	ENTREZGENE
	ENSRNOT00000022341.5	UniProtKB/Swiss-Prot
	ENSRNOT00055025948	UniProtKB/Swiss-Prot
	ENSRNOT00060035450	UniProtKB/Swiss-Prot
	ENSRNOT00065016236	UniProtKB/Swiss-Prot
InterPro	Ninjurin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25338	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25338	ENTREZGENE
PANTHER	NINJURIN-1	UniProtKB/TrEMBL
	NINJURIN-RELATED	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	PTHR12316:SF19	UniProtKB/Swiss-Prot
Pfam	Ninjurin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ninj1	PhenoGen
RatGTEx	ENSRNOG00000016587	RatGTEx
	ENSRNOG00055015164	RatGTEx
	ENSRNOG00060020471	RatGTEx
	ENSRNOG00065010091	RatGTEx
TIGR	TC205662
UniProt	A6J6X6	ENTREZGENE, UniProtKB/TrEMBL
	A6J6X7_RAT	UniProtKB/TrEMBL
	A6J6X8	ENTREZGENE, UniProtKB/TrEMBL
	A6J6X9	ENTREZGENE, UniProtKB/TrEMBL
	NINJ1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-11-06	Ninj1	ninjurin 1		Ninjurin	Symbol and Name updated	625702	APPROVED
2002-06-10	Ninj1	Ninjurin			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the cell surface	729059
gene_process	may play a role in nerve regeneration	729059

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD