Symbol:
Grm2
Name:
glutamate metabotropic receptor 2
RGD ID:
2743
Description:
Enables group II metabotropic glutamate receptor activity and scaffold protein binding activity. Involved in several processes, including behavioral response to nicotine; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and regulation of amine transport. Located in astrocyte projection and axon. Is active in presynaptic membrane. Used to study heroin dependence. Biomarker of schizophrenia. Orthologous to human GRM2 (glutamate metabotropic receptor 2); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH (+)-pilocarpine; (S)-nicotine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutamate receptor, metabotropic 2; metabotropic glutamate receptor 2; mGlu2; mGluR2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GRM2 (glutamate metabotropic receptor 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Grm2 (glutamate receptor, metabotropic 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Grm2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GRM2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GRM2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Grm2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GRM2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GRM2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Grm2 (glutamate metabotropic receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GRM2 (glutamate metabotropic receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Grm2 (glutamate receptor, metabotropic 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
grm2b (glutamate receptor, metabotropic 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
grm2a (glutamate receptor, metabotropic 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
mGluR
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mgl-1
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
grm2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Grm2em1
Genetic Models:
WI-Grm2em1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 116,158,810 - 116,171,857 (-) NCBI GRCr8 mRatBN7.2 8 107,280,099 - 107,293,159 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 107,280,099 - 107,293,146 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,903,031 - 112,916,129 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 111,102,213 - 111,115,309 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,944,991 - 108,958,085 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 115,344,999 - 115,358,628 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 115,344,999 - 115,358,046 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,705,123 - 114,718,193 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 111,837,086 - 111,850,133 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 111,857,819 - 111,869,581 (-) NCBI Celera 8 106,592,051 - 106,605,096 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grm2 Rat (+)-pilocarpine decreases expression EXP 6480464 Pilocarpine results in decreased expression of GRM2 mRNA and Pilocarpine results in decreased expression of GRM2 protein CTD PMID:16793029 more ... Grm2 Rat (S)-nicotine affects expression EXP 6480464 Nicotine affects the expression of GRM2 mRNA CTD PMID:28339662 Grm2 Rat 17beta-estradiol increases activity EXP 6480464 Estradiol results in increased activity of GRM2 protein CTD PMID:15901789 Grm2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Grm2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Grm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases methylation ISO Grm2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased methylation of GRM2 gene CTD PMID:21212295 Grm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GRM2 mRNA CTD PMID:33387578 Grm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRM2 mRNA CTD PMID:32109520 Grm2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Grm2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Grm2 (Mus musculus) 6480464 bisphenol S results in decreased expression of GRM2 mRNA CTD PMID:30951980 Grm2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GRM2 mRNA CTD PMID:36041667 Grm2 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of GRM2 mRNA CTD PMID:21346803 Grm2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GRM2 mRNA CTD PMID:24780913 Grm2 Rat acrylamide decreases expression ISO GRM2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of GRM2 mRNA CTD PMID:32763439 Grm2 Rat aflatoxin B1 decreases expression ISO GRM2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GRM2 mRNA CTD PMID:22100608 Grm2 Rat amiodarone increases expression ISO GRM2 (Homo sapiens) 6480464 Amiodarone results in increased expression of GRM2 mRNA CTD PMID:19774075 Grm2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GRM2 mRNA CTD PMID:16483693 Grm2 Rat aristolochic acid A increases expression ISO GRM2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GRM2 mRNA CTD PMID:33212167 Grm2 Rat arsane affects methylation ISO GRM2 (Homo sapiens) 6480464 Arsenic affects the methylation of GRM2 gene CTD PMID:25304211 Grm2 Rat arsenic atom affects methylation ISO GRM2 (Homo sapiens) 6480464 Arsenic affects the methylation of GRM2 gene CTD PMID:25304211 Grm2 Rat benzo[a]pyrene increases methylation ISO GRM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GRM2 3' UTR more ... CTD PMID:27901495 Grm2 Rat benzo[a]pyrene affects methylation ISO GRM2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GRM2 5' UTR CTD PMID:27901495 Grm2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of GRM2 mRNA CTD PMID:15620428 Grm2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRM2 mRNA CTD PMID:25181051 more ... Grm2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GRM2 mRNA CTD PMID:36041667 Grm2 Rat bisphenol A decreases expression ISO Grm2 (Mus musculus) 6480464 bisphenol A results in decreased expression of GRM2 mRNA CTD PMID:30951980 Grm2 Rat bisphenol F decreases expression ISO Grm2 (Mus musculus) 6480464 bisphenol F results in decreased expression of GRM2 mRNA CTD PMID:30951980 and PMID:36706583 Grm2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GRM2 mRNA CTD PMID:36041667 Grm2 Rat carbamazepine affects expression ISO GRM2 (Homo sapiens) 6480464 Carbamazepine affects the expression of GRM2 mRNA CTD PMID:25979313 Grm2 Rat CGP 52608 multiple interactions ISO GRM2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GRM2 gene] CTD PMID:28238834 Grm2 Rat chaetocin multiple interactions EXP 6480464 chaetocin affects the reaction [Dronabinol affects the expression of GRM2 mRNA] CTD PMID:29022873 and PMID:29481316 Grm2 Rat chlordecone multiple interactions ISO Grm2 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to GRM2 gene] CTD PMID:31084621 Grm2 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GRM2 mRNA CTD PMID:17452286 Grm2 Rat cocaine increases activity EXP 6480464 Cocaine results in increased activity of GRM2 protein CTD PMID:20416862 Grm2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GRM2 protein CTD PMID:19105975 Grm2 Rat cocaine decreases activity EXP 6480464 Cocaine results in decreased activity of GRM2 protein CTD PMID:18673447 Grm2 Rat curcumin decreases expression ISO Grm2 (Mus musculus) 6480464 Curcumin results in decreased expression of GRM2 protein CTD PMID:25406541 Grm2 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of GRM2 mRNA CTD PMID:17452286 Grm2 Rat entinostat decreases expression ISO GRM2 (Homo sapiens) 6480464 entinostat results in decreased expression of GRM2 mRNA CTD PMID:27188386 Grm2 Rat epoxiconazole decreases expression ISO Grm2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of GRM2 mRNA CTD PMID:35436446 Grm2 Rat ethanol affects expression ISO Grm2 (Mus musculus) 6480464 Ethanol affects the expression of GRM2 mRNA CTD PMID:30319688 Grm2 Rat ethanol increases expression ISO Grm2 (Mus musculus) 6480464 Ethanol results in increased expression of GRM2 mRNA CTD PMID:30319688 Grm2 Rat ethylparaben decreases expression ISO GRM2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of GRM2 mRNA CTD PMID:37690743 Grm2 Rat fonofos increases methylation ISO GRM2 (Homo sapiens) 6480464 Fonofos results in increased methylation of GRM2 promoter CTD PMID:22847954 Grm2 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of GRM2 mRNA CTD PMID:18923069 Grm2 Rat mescaline multiple interactions ISO Grm2 (Mus musculus) 6480464 [Piperidines results in increased activity of GRM2 protein] which results in decreased susceptibility to Mescaline CTD PMID:21366332 Grm2 Rat methamphetamine increases response to substance ISO GRM2 (Homo sapiens) 6480464 GRM2 gene SNP results in increased susceptibility to Methamphetamine CTD PMID:20211215 Grm2 Rat methamphetamine multiple interactions ISO Grm2 (Mus musculus) 6480464 [Piperidines results in increased activity of GRM2 protein] which results in decreased susceptibility to Methamphetamine CTD PMID:21366332 Grm2 Rat methylisothiazolinone increases expression ISO GRM2 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of GRM2 mRNA CTD PMID:31629900 Grm2 Rat N-acetyl-L-cysteine increases activity ISO GRM2 (Homo sapiens) 6480464 Acetylcysteine results in increased activity of GRM2 protein CTD PMID:19136971 Grm2 Rat nicotine affects expression EXP 6480464 Nicotine affects the expression of GRM2 mRNA CTD PMID:28339662 Grm2 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of GRM2 mRNA CTD PMID:15620428 Grm2 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of GRM2 mRNA CTD PMID:15206577 Grm2 Rat parathion increases methylation ISO GRM2 (Homo sapiens) 6480464 Parathion results in increased methylation of GRM2 promoter CTD PMID:22847954 Grm2 Rat permethrin increases expression ISO GRM2 (Homo sapiens) 6480464 Permethrin results in increased expression of GRM2 mRNA CTD PMID:37047231 Grm2 Rat piperidines multiple interactions ISO Grm2 (Mus musculus) 6480464 [Piperidines results in increased activity of GRM2 protein] which results in decreased susceptibility to Mescaline and [Piperidines results in increased activity of GRM2 protein] which results in decreased susceptibility to Methamphetamine CTD PMID:21366332 Grm2 Rat rotenone decreases expression ISO GRM2 (Homo sapiens) 6480464 Rotenone results in decreased expression of GRM2 mRNA CTD PMID:29955902 Grm2 Rat sodium arsenite decreases expression ISO Grm2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GRM2 protein CTD PMID:29748927 Grm2 Rat sodium fluoride multiple interactions ISO Grm2 (Mus musculus) 6480464 [Sodium Fluoride results in increased abundance of Fluorides] which results in decreased expression of GRM2 mRNA CTD PMID:29187078 Grm2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of GRM2 mRNA CTD PMID:19281266 Grm2 Rat terbufos increases methylation ISO GRM2 (Homo sapiens) 6480464 terbufos results in increased methylation of GRM2 promoter CTD PMID:22847954 Grm2 Rat titanium dioxide decreases expression ISO Grm2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GRM2 mRNA and titanium dioxide results in decreased expression of GRM2 protein CTD PMID:25411160 Grm2 Rat titanium dioxide increases methylation ISO Grm2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of GRM2 gene CTD PMID:35295148 Grm2 Rat titanium dioxide decreases methylation ISO Grm2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GRM2 gene CTD PMID:35295148 Grm2 Rat triclosan increases expression ISO GRM2 (Homo sapiens) 6480464 Triclosan results in increased expression of GRM2 mRNA CTD PMID:30510588 Grm2 Rat triptonide increases expression ISO Grm2 (Mus musculus) 6480464 triptonide results in increased expression of GRM2 mRNA CTD PMID:33045310 Grm2 Rat tunicamycin increases expression ISO Grm2 (Mus musculus) 6480464 Tunicamycin results in increased expression of GRM2 mRNA CTD PMID:17127020 Grm2 Rat valproic acid affects expression ISO Grm2 (Mus musculus) 6480464 Valproic Acid affects the expression of GRM2 mRNA CTD PMID:17963808
Imported Annotations - KEGG (archival)
(+)-pilocarpine (EXP) (S)-nicotine (EXP) 17beta-estradiol (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) amiodarone (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) carbamazepine (ISO) CGP 52608 (ISO) chaetocin (EXP) chlordecone (ISO) chlorpyrifos (EXP) cocaine (EXP) curcumin (ISO) diazinon (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) ethylparaben (ISO) fonofos (ISO) haloperidol (EXP) mescaline (ISO) methamphetamine (ISO) methylisothiazolinone (ISO) N-acetyl-L-cysteine (ISO) nicotine (EXP) Nonylphenol (EXP) paraquat (EXP) parathion (ISO) permethrin (ISO) piperidines (ISO) rotenone (ISO) sodium arsenite (ISO) sodium fluoride (ISO) Soman (EXP) terbufos (ISO) titanium dioxide (ISO) triclosan (ISO) triptonide (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
Subsynaptic mobility of presynaptic mGluR types is differentially regulated by intra- and extracellular interactions.
Bodzęta A, etal., Mol Biol Cell. 2022 Jul 1;33(8):ar66. doi: 10.1091/mbc.E21-10-0484. Epub 2022 May 5.
2.
PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.
Dev KK, etal., J Neurosci. 2000 Oct 1;20(19):7252-7.
3.
Differences in 5-HT2A and mGlu2 Receptor Expression Levels and Repressive Epigenetic Modifications at the 5-HT2A Promoter Region in the Roman Low- (RLA-I) and High- (RHA-I) Avoidance Rat Strains.
Fomsgaard L, etal., Mol Neurobiol. 2018 Mar;55(3):1998-2012. doi: 10.1007/s12035-017-0457-y. Epub 2017 Mar 6.
4.
Deletion of the type 2 metabotropic glutamate receptor increases heroin abuse vulnerability in transgenic rats.
Gao JT, etal., Neuropsychopharmacology. 2018 Dec;43(13):2615-2626. doi: 10.1038/s41386-018-0231-5. Epub 2018 Oct 3.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Differential plasma membrane distribution of metabotropic glutamate receptors mGluR1 alpha, mGluR2 and mGluR5, relative to neurotransmitter release sites.
Luján R, etal., J Chem Neuroanat. 1997 Oct;13(4):219-41.
8.
Different roles of group I and group II metabotropic glutamate receptors on phencyclidine-induced dopamine release in the rat prefrontal cortex.
Maeda J, etal., Neurosci Lett 2003 Jan 23;336(3):171-4.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
Metabotropic glutamate receptor 2 modulates excitatory synaptic transmission in the rat globus pallidus.
Poisik O, etal., Neuropharmacology. 2005;49 Suppl 1:57-69.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Group II metabotropic glutamate receptor interactions with NHERF scaffold proteins: Implications for receptor localization in brain.
Ritter-Makinson SL, etal., Neuroscience. 2017 Jun 14;353:58-75. doi: 10.1016/j.neuroscience.2017.03.060. Epub 2017 Apr 7.
17.
Crosstalk between GABAB and mGlu1a receptors reveals new insight into GPCR signal integration.
Rives ML, etal., EMBO J. 2009 Aug 5;28(15):2195-208. doi: 10.1038/emboj.2009.177. Epub 2009 Jul 9.
18.
Enhancement of low-voltage-activated calcium currents by group II metabotropic glutamate receptors in rat retinal ganglion cells.
Robbins J, etal., Mol Cell Neurosci 2003 Jul;23(3):341-50.
19.
Ethanol concentration-dependent alterations in gene expression during acute binge drinking in the HIV-1 transgenic rat.
Sarkar S and Chang SL, Alcohol Clin Exp Res. 2013 Jul;37(7):1082-90. doi: 10.1111/acer.12077. Epub 2013 Feb 15.
20.
RanBPM is expressed in synaptic layers of the mammalian retina and binds to metabotropic glutamate receptors.
Seebahn A, etal., FEBS Lett. 2008 Jul 9;582(16):2453-7. doi: 10.1016/j.febslet.2008.06.010. Epub 2008 Jun 13.
21.
A family of metabotropic glutamate receptors.
Tanabe Y, etal., Neuron 1992 Jan;8(1):169-79.
22.
Deletion of Type 2 Metabotropic Glutamate Receptor Decreases Sensitivity to Cocaine Reward in Rats.
Yang HJ, etal., Cell Rep. 2017 Jul 11;20(2):319-332. doi: 10.1016/j.celrep.2017.06.046.
Grm2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 116,158,810 - 116,171,857 (-) NCBI GRCr8 mRatBN7.2 8 107,280,099 - 107,293,159 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 107,280,099 - 107,293,146 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,903,031 - 112,916,129 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 111,102,213 - 111,115,309 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,944,991 - 108,958,085 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 115,344,999 - 115,358,628 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 115,344,999 - 115,358,046 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,705,123 - 114,718,193 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 111,837,086 - 111,850,133 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 111,857,819 - 111,869,581 (-) NCBI Celera 8 106,592,051 - 106,605,096 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
GRM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 51,707,068 - 51,718,613 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 51,707,068 - 51,718,613 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 51,741,084 - 51,752,629 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 51,718,004 - 51,727,669 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 51,718,037 - 51,727,168 NCBI Celera 3 51,718,848 - 51,731,506 (+) NCBI Celera Cytogenetic Map 3 p21.2 NCBI HuRef 3 51,802,839 - 51,816,142 (+) NCBI HuRef CHM1_1 3 51,693,893 - 51,705,447 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 51,738,578 - 51,751,605 (+) NCBI T2T-CHM13v2.0
Grm2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 106,521,733 - 106,533,308 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 106,520,294 - 106,533,281 (-) Ensembl GRCm39 Ensembl GRCm38 9 106,644,534 - 106,656,109 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 106,643,095 - 106,656,082 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 106,546,865 - 106,558,440 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 106,546,755 - 106,558,434 (-) NCBI MGSCv36 mm8 Celera 9 106,265,562 - 106,277,130 (-) NCBI Celera Cytogenetic Map 9 F1 NCBI cM Map 9 57.98 NCBI
Grm2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 3,309,028 - 3,320,966 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 3,309,034 - 3,320,954 (+) NCBI ChiLan1.0 ChiLan1.0
GRM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 51,694,559 - 51,707,434 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 51,699,333 - 51,712,208 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 51,639,792 - 51,652,779 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 52,873,144 - 52,884,401 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 52,873,144 - 52,884,395 (+) Ensembl panpan1.1 panPan2
GRM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 37,915,178 - 37,926,276 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 37,915,665 - 37,924,296 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 37,895,193 - 37,906,256 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 38,264,331 - 38,275,394 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 38,264,304 - 38,275,372 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 37,627,888 - 37,638,953 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 38,036,604 - 38,047,669 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 38,321,755 - 38,332,818 (-) NCBI UU_Cfam_GSD_1.0
Grm2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 66,281,725 - 66,293,182 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936529 3,042,248 - 3,053,673 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936529 3,042,220 - 3,053,670 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRM2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 33,926,804 - 33,938,269 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 33,924,303 - 33,938,279 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 37,130,553 - 37,141,351 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 13,044,974 - 13,056,469 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 13,046,641 - 13,056,453 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 153,898,374 - 153,910,372 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grm2
.
Predicted Target Of
Count of predictions: 437 Count of miRNA genes: 228 Interacting mature miRNAs: 281 Transcripts: ENSRNOT00000017607 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
This gene Grm2 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
10
16
113
62
61
30
25
30
6
127
61
93
20
51
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017607 ⟹ ENSRNOP00000017607
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 107,280,099 - 107,293,146 (-) Ensembl Rnor_6.0 Ensembl 8 115,344,999 - 115,358,046 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098540 ⟹ ENSRNOP00000091771
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 107,282,024 - 107,293,146 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101861 ⟹ ENSRNOP00000081739
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 107,280,099 - 107,293,146 (-) Ensembl
RefSeq Acc Id:
NM_001105711 ⟹ NP_001099181
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 116,158,810 - 116,171,857 (-) NCBI mRatBN7.2 8 107,280,099 - 107,293,146 (-) NCBI Rnor_6.0 8 115,344,999 - 115,358,046 (-) NCBI Rnor_5.0 8 114,705,123 - 114,718,193 (-) NCBI RGSC_v3.4 8 111,837,086 - 111,850,133 (-) RGD Celera 8 106,592,051 - 106,605,096 (-) RGD
Sequence:
AGAGCCAGCGAGAGAGCCAGCAAGCGGGAACCGGAGCCCCGCGCCAGAGCTGGGCGCGCCAGGAGCTGACCCCCTCCTCATCTCTCTTCCTGTCTGTCCTTTCCTGGCCCCTGTTTCCTCCTCTCTTT
hide sequence
RefSeq Acc Id:
XM_063264894 ⟹ XP_063120964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 116,160,086 - 116,171,844 (-) NCBI
RefSeq Acc Id:
NP_001099181 ⟸ NM_001105711
- Peptide Label:
precursor
- UniProtKB:
P31421 (UniProtKB/Swiss-Prot), A6I2U6 (UniProtKB/TrEMBL), A0A8I6AGD5 (UniProtKB/TrEMBL)
- Sequence:
MESLLGFLALLLLWGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGGPAEECGPVNEHRGIQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRGADGSRHICPDGSYAT
hide sequence
Ensembl Acc Id:
ENSRNOP00000017607 ⟸ ENSRNOT00000017607
Ensembl Acc Id:
ENSRNOP00000081739 ⟸ ENSRNOT00000101861
Ensembl Acc Id:
ENSRNOP00000091771 ⟸ ENSRNOT00000098540
RefSeq Acc Id:
XP_063120964 ⟸ XM_063264894
- Peptide Label:
isoform X1
- UniProtKB:
P31421 (UniProtKB/Swiss-Prot), A6I2U6 (UniProtKB/TrEMBL), A0A8I6AGD5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-13
Grm2
glutamate metabotropic receptor 2
Grm2
glutamate receptor, metabotropic 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-27
Grm2
glutamate receptor, metabotropic 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Grm2
glutamate receptor, metabotropic 2
Glutamate receptor, metabotropic 2
Name updated
625702 APPROVED
2002-06-10
Grm2
Glutamate receptor, metabotropic 2
Symbol and Name status set to approved
70586 APPROVED
