Symbol:
Rgs16
Name:
regulator of G-protein signaling 16
RGD ID:
1589741
Description:
Predicted to enable GTPase activator activity. Predicted to be involved in G protein-coupled receptor signaling pathway and positive regulation of GTPase activity. Predicted to be located in cytoplasm and membrane. Orthologous to human RGS16 (regulator of G protein signaling 16); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
regulator of G-protein signaling 16 (mapped); retinal-specific RGS; retinally abundant regulator of G-protein signaling; RGS-R; Rgs16_mapped
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 68,421,480 - 68,443,312 (+) NCBI GRCr8 mRatBN7.2 13 65,887,668 - 65,892,862 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 65,887,530 - 65,892,857 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 68,488,860 - 68,492,298 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 69,779,050 - 69,782,494 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 67,032,029 - 67,035,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 71,163,411 - 71,185,147 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 71,179,910 - 71,185,216 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 76,128,653 - 76,150,399 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 68,807,863 - 68,811,307 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 65,788,298 - 65,791,737 (+) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rgs16 Rat (-)-demecolcine increases expression ISO RGS16 (Homo sapiens) 6480464 Demecolcine results in increased expression of RGS16 mRNA CTD PMID:23649840 Rgs16 Rat (S)-colchicine decreases expression ISO RGS16 (Homo sapiens) 6480464 Colchicine results in decreased expression of RGS16 mRNA CTD PMID:24211769 Rgs16 Rat 1,2-dimethylhydrazine decreases expression ISO Rgs16 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RGS16 mRNA CTD PMID:22206623 Rgs16 Rat 1-fluoro-2,4-dinitrobenzene increases expression ISO RGS16 (Homo sapiens) 6480464 Dinitrofluorobenzene results in increased expression of RGS16 mRNA CTD PMID:23999411 Rgs16 Rat 15-acetyldeoxynivalenol increases expression ISO RGS16 (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of RGS16 mRNA CTD PMID:23792671 Rgs16 Rat 17beta-estradiol increases expression ISO RGS16 (Homo sapiens) 6480464 Estradiol results in increased expression of RGS16 mRNA CTD PMID:19153601 Rgs16 Rat 17beta-estradiol decreases expression ISO Rgs16 (Mus musculus) 6480464 Estradiol results in decreased expression of RGS16 mRNA CTD PMID:39298647 Rgs16 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of RGS16 mRNA CTD PMID:32145629 Rgs16 Rat 17beta-estradiol multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of RGS16 mRNA CTD PMID:30165855 Rgs16 Rat 17beta-estradiol multiple interactions ISO Rgs16 (Mus musculus) 6480464 bisphenol A inhibits the reaction [Estradiol results in increased expression of RGS16 mRNA] CTD PMID:28476547 Rgs16 Rat 17beta-estradiol increases expression ISO Rgs16 (Mus musculus) 6480464 Estradiol results in increased expression of RGS16 mRNA CTD PMID:28476547 Rgs16 Rat 17beta-estradiol affects expression ISO Rgs16 (Mus musculus) 6480464 Estradiol affects the expression of RGS16 mRNA CTD PMID:15598610 Rgs16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RGS16 mRNA CTD PMID:22298810 and PMID:34747641 Rgs16 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rgs16 (Mus musculus) 6480464 TIPARP gene mutant form promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of RGS16 mRNA] CTD PMID:34129049 Rgs16 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RGS16 mRNA CTD PMID:32109520 Rgs16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rgs16 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RGS16 mRNA CTD PMID:21570461 more ... Rgs16 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rgs16 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RGS16 mRNA CTD PMID:19770486 and PMID:25270620 Rgs16 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Rgs16 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Rgs16 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Rgs16 Rat 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one decreases expression ISO Rgs16 (Mus musculus) 6480464 Itraconazole results in decreased expression of RGS16 mRNA CTD PMID:31099283 Rgs16 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Rgs16 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Rgs16 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rgs16 (Mus musculus) 6480464 bisphenol S results in decreased expression of RGS16 mRNA CTD PMID:30951980 more ... Rgs16 Rat 4-hydroxyphenyl retinamide increases expression ISO Rgs16 (Mus musculus) 6480464 Fenretinide results in increased expression of RGS16 mRNA CTD PMID:28973697 Rgs16 Rat 5-fluorouracil affects expression ISO RGS16 (Homo sapiens) 6480464 Fluorouracil affects the expression of RGS16 mRNA CTD PMID:15205334 Rgs16 Rat 8-Br-cAMP increases expression ISO RGS16 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of RGS16 mRNA CTD PMID:22079614 Rgs16 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of RGS16 mRNA CTD PMID:31881176 Rgs16 Rat acrolein increases expression EXP 6480464 Acrolein results in increased expression of RGS16 mRNA CTD PMID:38090360 Rgs16 Rat acrylamide increases expression ISO RGS16 (Homo sapiens) 6480464 Acrylamide results in increased expression of RGS16 mRNA CTD PMID:32763439 Rgs16 Rat actinomycin D multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of RGS16 mRNA CTD PMID:38460933 Rgs16 Rat adenine decreases expression ISO RGS16 (Homo sapiens) 6480464 Adenine results in decreased expression of RGS16 mRNA CTD PMID:24211769 Rgs16 Rat afimoxifene increases expression ISO RGS16 (Homo sapiens) 6480464 afimoxifene results in increased expression of RGS16 mRNA CTD PMID:19153601 Rgs16 Rat afimoxifene multiple interactions ISO RGS16 (Homo sapiens) 6480464 GPER1 protein affects the reaction [afimoxifene results in increased expression of RGS16 mRNA] CTD PMID:19153601 Rgs16 Rat aflatoxin B1 decreases expression ISO Rgs16 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of RGS16 mRNA CTD PMID:19770486 Rgs16 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of RGS16 mRNA CTD PMID:25378103 Rgs16 Rat aflatoxin B1 increases expression ISO RGS16 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of RGS16 mRNA CTD PMID:22100608 and PMID:32234424 Rgs16 Rat all-trans-retinoic acid decreases expression ISO RGS16 (Homo sapiens) 6480464 Tretinoin results in decreased expression of RGS16 mRNA CTD PMID:15498508 more ... Rgs16 Rat all-trans-retinoic acid multiple interactions ISO Rgs16 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of RGS16 mRNA CTD PMID:36189433 Rgs16 Rat all-trans-retinoic acid increases expression ISO RGS16 (Homo sapiens) 6480464 Tretinoin results in increased expression of RGS16 mRNA CTD PMID:16012519 and PMID:23724009 Rgs16 Rat antirheumatic drug decreases expression ISO RGS16 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of RGS16 mRNA CTD PMID:24449571 Rgs16 Rat arsenite(3-) affects expression ISO Rgs16 (Mus musculus) 6480464 arsenite affects the expression of RGS16 mRNA CTD PMID:33053406 Rgs16 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of RGS16 mRNA CTD PMID:36841081 Rgs16 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of RGS16 mRNA CTD PMID:33854195 Rgs16 Rat benzo[a]pyrene decreases expression ISO Rgs16 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RGS16 mRNA CTD PMID:19770486 and PMID:32417428 Rgs16 Rat benzo[a]pyrene increases expression ISO RGS16 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of RGS16 mRNA CTD PMID:32234424 Rgs16 Rat benzoates affects expression ISO RGS16 (Homo sapiens) 6480464 Benzoates analog affects the expression of RGS16 mRNA CTD PMID:29472718 Rgs16 Rat beta-lapachone increases expression ISO RGS16 (Homo sapiens) 6480464 beta-lapachone results in increased expression of RGS16 mRNA CTD PMID:38218311 Rgs16 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of RGS16 mRNA CTD PMID:18164116 Rgs16 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rgs16 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RGS16 mRNA CTD PMID:19850644 Rgs16 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGS16 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of RGS16 mRNA CTD PMID:31163220 Rgs16 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Rgs16 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of RGS16 mRNA] CTD PMID:19850644 Rgs16 Rat bisphenol A multiple interactions ISO Rgs16 (Mus musculus) 6480464 bisphenol A inhibits the reaction [Estradiol results in increased expression of RGS16 mRNA] CTD PMID:28476547 Rgs16 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RGS16 mRNA CTD PMID:30903817 Rgs16 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RGS16 mRNA CTD PMID:30816183 and PMID:32528016 Rgs16 Rat bisphenol A decreases methylation ISO Rgs16 (Mus musculus) 6480464 bisphenol A results in decreased methylation of RGS16 promoter CTD PMID:27312807 Rgs16 Rat bisphenol A increases expression ISO Rgs16 (Mus musculus) 6480464 bisphenol A results in increased expression of RGS16 mRNA CTD PMID:28476547 and PMID:30566610 Rgs16 Rat bisphenol A decreases expression ISO RGS16 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RGS16 mRNA CTD PMID:27685785 Rgs16 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RGS16 mRNA CTD PMID:25181051 and PMID:32145629 Rgs16 Rat bisphenol F decreases expression ISO Rgs16 (Mus musculus) 6480464 bisphenol F results in decreased expression of RGS16 mRNA CTD PMID:30951980 Rgs16 Rat butanal increases expression ISO RGS16 (Homo sapiens) 6480464 butyraldehyde results in increased expression of RGS16 mRNA CTD PMID:26079696 Rgs16 Rat Butylbenzyl phthalate increases expression ISO Rgs16 (Mus musculus) 6480464 butylbenzyl phthalate results in increased expression of RGS16 mRNA CTD PMID:32308655 Rgs16 Rat cadmium atom multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RGS16 mRNA CTD PMID:31738976 Rgs16 Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of RGS16 promoter CTD PMID:22457795 Rgs16 Rat cadmium dichloride decreases expression ISO RGS16 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RGS16 mRNA CTD PMID:38382870 Rgs16 Rat cadmium dichloride multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RGS16 mRNA CTD PMID:31738976 Rgs16 Rat calcitriol decreases expression ISO RGS16 (Homo sapiens) 6480464 Calcitriol results in decreased expression of RGS16 mRNA CTD PMID:26485663 Rgs16 Rat camptothecin increases expression ISO RGS16 (Homo sapiens) 6480464 Camptothecin results in increased expression of RGS16 mRNA CTD PMID:38460933 Rgs16 Rat carbon nanotube affects expression ISO Rgs16 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of RGS16 mRNA CTD PMID:25620056 Rgs16 Rat carbon nanotube decreases expression ISO Rgs16 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of RGS16 mRNA CTD PMID:25620056 Rgs16 Rat carbon nanotube increases expression ISO Rgs16 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Rgs16 Rat CGP 52608 multiple interactions ISO RGS16 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RGS16 gene] CTD PMID:28238834 Rgs16 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of RGS16 mRNA CTD PMID:33854195 Rgs16 Rat choline multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat cisplatin increases expression ISO RGS16 (Homo sapiens) 6480464 Cisplatin results in increased expression of RGS16 mRNA CTD PMID:27392435 and PMID:27594783 Rgs16 Rat cisplatin multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RGS16 mRNA CTD PMID:27392435 Rgs16 Rat clofibrate multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RGS16 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RGS16 mRNA] CTD PMID:17585979 Rgs16 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of RGS16 mRNA CTD PMID:32741897 Rgs16 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of RGS16 mRNA CTD PMID:17602206 Rgs16 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of RGS16 mRNA CTD PMID:26033743 Rgs16 Rat copper atom multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of RGS16 mRNA CTD PMID:24690739 Rgs16 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of RGS16 mRNA CTD PMID:26033743 Rgs16 Rat copper(0) multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of RGS16 mRNA CTD PMID:24690739 Rgs16 Rat copper(II) sulfate increases expression ISO RGS16 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of RGS16 mRNA CTD PMID:19549813 Rgs16 Rat curcumin increases expression ISO RGS16 (Homo sapiens) 6480464 Curcumin results in increased expression of RGS16 mRNA CTD PMID:17198877 Rgs16 Rat cyanocob(III)alamin multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat cyclosporin A increases expression ISO RGS16 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RGS16 mRNA CTD PMID:20106945 and PMID:27989131 Rgs16 Rat cyclosporin A decreases expression ISO RGS16 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RGS16 mRNA CTD PMID:22147139 Rgs16 Rat cyclosporin A decreases expression ISO Rgs16 (Mus musculus) 6480464 Cyclosporine results in decreased expression of RGS16 mRNA CTD PMID:19770486 Rgs16 Rat DDE decreases expression ISO RGS16 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of RGS16 mRNA CTD PMID:38568856 Rgs16 Rat dexamethasone multiple interactions ISO Rgs16 (Mus musculus) 6480464 apicidin inhibits the reaction [Dexamethasone results in decreased expression of RGS16 mRNA] more ... CTD PMID:27645313 Rgs16 Rat dexamethasone increases expression ISO Rgs16 (Mus musculus) 6480464 Dexamethasone results in increased expression of RGS16 mRNA CTD PMID:22733784 Rgs16 Rat dexamethasone decreases expression ISO Rgs16 (Mus musculus) 6480464 Dexamethasone results in decreased expression of RGS16 mRNA CTD PMID:27645313 Rgs16 Rat dibutyl phthalate increases expression ISO Rgs16 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RGS16 mRNA CTD PMID:21266533 Rgs16 Rat dichloroacetic acid increases expression ISO Rgs16 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of RGS16 mRNA CTD PMID:28962523 Rgs16 Rat diclofenac decreases expression ISO Rgs16 (Mus musculus) 6480464 Diclofenac results in decreased expression of RGS16 mRNA CTD PMID:35537566 Rgs16 Rat dinophysistoxin 1 increases expression ISO RGS16 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of RGS16 mRNA CTD PMID:21853993 and PMID:28939011 Rgs16 Rat dioxygen multiple interactions ISO Rgs16 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of RGS16 mRNA CTD PMID:30529165 Rgs16 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of RGS16 mRNA CTD PMID:33729688 Rgs16 Rat disulfiram multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of RGS16 mRNA CTD PMID:24690739 Rgs16 Rat doxorubicin affects expression ISO RGS16 (Homo sapiens) 6480464 Doxorubicin affects the expression of RGS16 mRNA CTD PMID:15205334 Rgs16 Rat doxorubicin increases expression ISO RGS16 (Homo sapiens) 6480464 Doxorubicin results in increased expression of RGS16 mRNA CTD PMID:30031762 Rgs16 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RGS16 mRNA CTD PMID:29391264 Rgs16 Rat epoxiconazole affects expression ISO Rgs16 (Mus musculus) 6480464 epoxiconazole affects the expression of RGS16 mRNA CTD PMID:35436446 Rgs16 Rat ethyl methanesulfonate increases expression ISO RGS16 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of RGS16 mRNA CTD PMID:23649840 Rgs16 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of RGS16 mRNA CTD PMID:32741897 Rgs16 Rat fenthion increases expression ISO Rgs16 (Mus musculus) 6480464 Fenthion results in increased expression of RGS16 mRNA CTD PMID:34813904 Rgs16 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of RGS16 mRNA CTD PMID:37156404 Rgs16 Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of RGS16 mRNA CTD PMID:38615722 Rgs16 Rat folic acid multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat folic acid decreases expression ISO Rgs16 (Mus musculus) 6480464 Folic Acid results in decreased expression of RGS16 mRNA CTD PMID:25629700 Rgs16 Rat formaldehyde increases expression ISO RGS16 (Homo sapiens) 6480464 Formaldehyde results in increased expression of RGS16 mRNA CTD PMID:17938736 and PMID:23649840 Rgs16 Rat fumonisin B1 decreases expression ISO Rgs16 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of RGS16 mRNA CTD PMID:16221962 Rgs16 Rat furan decreases expression ISO Rgs16 (Mus musculus) 6480464 furan results in decreased expression of RGS16 mRNA CTD PMID:24183702 Rgs16 Rat genistein decreases expression ISO RGS16 (Homo sapiens) 6480464 Genistein results in decreased expression of RGS16 mRNA CTD PMID:15256057 Rgs16 Rat genistein increases expression ISO Rgs16 (Mus musculus) 6480464 Genistein results in increased expression of RGS16 mRNA CTD PMID:32186404 Rgs16 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RGS16 mRNA CTD PMID:33387578 Rgs16 Rat glycine betaine multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of RGS16 mRNA CTD PMID:33854195 Rgs16 Rat hydrogen peroxide affects expression ISO RGS16 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RGS16 mRNA CTD PMID:20044591 Rgs16 Rat hydroxyurea increases expression ISO RGS16 (Homo sapiens) 6480464 Hydroxyurea results in increased expression of RGS16 mRNA CTD PMID:24211769 Rgs16 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of RGS16 mRNA CTD PMID:33854195 Rgs16 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of RGS16 mRNA CTD PMID:21396975 Rgs16 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of RGS16 mRNA CTD PMID:22129741 Rgs16 Rat inulin multiple interactions ISO Rgs16 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RGS16 mRNA CTD PMID:36331819 Rgs16 Rat itraconazole decreases expression ISO Rgs16 (Mus musculus) 6480464 Itraconazole results in decreased expression of RGS16 mRNA CTD PMID:31099283 Rgs16 Rat kainic acid decreases expression ISO Rgs16 (Mus musculus) 6480464 Kainic Acid results in decreased expression of RGS16 mRNA CTD PMID:17997037 Rgs16 Rat ketoconazole decreases expression ISO Rgs16 (Mus musculus) 6480464 Ketoconazole results in decreased expression of RGS16 mRNA CTD PMID:31099283 Rgs16 Rat L-methionine multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat Lasiocarpine increases expression ISO RGS16 (Homo sapiens) 6480464 lasiocarpine results in increased expression of RGS16 mRNA CTD PMID:32234424 Rgs16 Rat leflunomide decreases expression ISO Rgs16 (Mus musculus) 6480464 leflunomide results in decreased expression of RGS16 mRNA CTD PMID:19751817 Rgs16 Rat Licochalcone B increases expression ISO RGS16 (Homo sapiens) 6480464 licochalcone B results in increased expression of RGS16 mRNA CTD PMID:33647349 Rgs16 Rat lipopolysaccharide decreases expression ISO Rgs16 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of RGS16 mRNA CTD PMID:27339419 Rgs16 Rat lipopolysaccharide multiple interactions ISO RGS16 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of RGS16 mRNA] CTD PMID:35811015 Rgs16 Rat lipopolysaccharide increases expression ISO RGS16 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of RGS16 mRNA CTD PMID:35811015 Rgs16 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of RGS16 mRNA CTD PMID:19588733 Rgs16 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of RGS16 mRNA CTD PMID:28801915 Rgs16 Rat melphalan increases expression ISO RGS16 (Homo sapiens) 6480464 Melphalan results in increased expression of RGS16 mRNA CTD PMID:22363485 Rgs16 Rat menadione affects expression ISO RGS16 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of RGS16 mRNA CTD PMID:20044591 Rgs16 Rat methyl methanesulfonate increases expression ISO RGS16 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of RGS16 mRNA CTD PMID:23649840 Rgs16 Rat methylisothiazolinone increases expression ISO RGS16 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of RGS16 mRNA CTD PMID:31629900 Rgs16 Rat methylmercury chloride increases expression ISO RGS16 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of RGS16 mRNA CTD PMID:28001369 Rgs16 Rat methylmercury chloride affects expression ISO RGS16 (Homo sapiens) 6480464 methylmercuric chloride affects the expression of RGS16 mRNA CTD PMID:34089799 Rgs16 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of RGS16 mRNA CTD PMID:31378766 Rgs16 Rat mitomycin C decreases expression ISO RGS16 (Homo sapiens) 6480464 Mitomycin results in decreased expression of RGS16 mRNA CTD PMID:24211769 Rgs16 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Rgs16 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of RGS16 mRNA CTD PMID:36189433 Rgs16 Rat N(6)-dimethylallyladenine decreases expression ISO RGS16 (Homo sapiens) 6480464 N(6)-(delta(2)-isopentenyl)adenine results in decreased expression of RGS16 mRNA CTD PMID:16129123 Rgs16 Rat N(6)-dimethylallyladenine increases expression ISO RGS16 (Homo sapiens) 6480464 N(6)-(delta(2)-isopentenyl)adenine results in increased expression of RGS16 mRNA CTD PMID:16129123 Rgs16 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of RGS16 mRNA CTD PMID:22129741 Rgs16 Rat N-methyl-4-phenylpyridinium increases expression ISO RGS16 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RGS16 mRNA CTD PMID:24810058 Rgs16 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of RGS16 mRNA CTD PMID:28801915 Rgs16 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of RGS16 mRNA more ... CTD PMID:17602206 more ... Rgs16 Rat N-nitrosodiethylamine increases expression ISO Rgs16 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of RGS16 mRNA CTD PMID:24535843 Rgs16 Rat N-Nitrosopyrrolidine increases expression ISO RGS16 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of RGS16 mRNA CTD PMID:32234424 Rgs16 Rat naphthalene increases expression ISO Rgs16 (Mus musculus) 6480464 naphthalene results in increased expression of RGS16 mRNA CTD PMID:18978301 Rgs16 Rat nevirapine increases expression ISO Rgs16 (Mus musculus) 6480464 Nevirapine results in increased expression of RGS16 mRNA CTD PMID:38636494 Rgs16 Rat nickel atom increases expression ISO RGS16 (Homo sapiens) 6480464 Nickel results in increased expression of RGS16 mRNA CTD PMID:24768652 and PMID:25583101 Rgs16 Rat nickel sulfate increases expression ISO RGS16 (Homo sapiens) 6480464 nickel sulfate results in increased expression of RGS16 mRNA CTD PMID:16780908 Rgs16 Rat Nutlin-3 multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of RGS16 mRNA CTD PMID:38460933 Rgs16 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of RGS16 mRNA CTD PMID:23665939 Rgs16 Rat ozone increases expression ISO Rgs16 (Mus musculus) 6480464 Ozone results in increased expression of RGS16 mRNA CTD PMID:25658374 and PMID:33026818 Rgs16 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of RGS16 mRNA CTD PMID:28623178 Rgs16 Rat ozone multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of RGS16 mRNA more ... CTD PMID:25658374 more ... Rgs16 Rat paracetamol multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RGS16 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RGS16 mRNA] CTD PMID:17585979 Rgs16 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RGS16 mRNA CTD PMID:33387578 Rgs16 Rat paracetamol increases expression ISO RGS16 (Homo sapiens) 6480464 Acetaminophen results in increased expression of RGS16 mRNA CTD PMID:21420995 and PMID:29067470 Rgs16 Rat paracetamol decreases expression ISO Rgs16 (Mus musculus) 6480464 Acetaminophen results in decreased expression of RGS16 mRNA CTD PMID:11264010 Rgs16 Rat pentachlorophenol decreases expression ISO Rgs16 (Mus musculus) 6480464 Pentachlorophenol results in decreased expression of RGS16 mRNA CTD PMID:23892564 Rgs16 Rat pentanal increases expression ISO RGS16 (Homo sapiens) 6480464 pentanal results in increased expression of RGS16 mRNA CTD PMID:26079696 Rgs16 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rgs16 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RGS16 mRNA CTD PMID:36331819 Rgs16 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of RGS16 mRNA CTD PMID:28511854 Rgs16 Rat phenobarbital decreases expression ISO Rgs16 (Mus musculus) 6480464 Phenobarbital results in decreased expression of RGS16 mRNA CTD PMID:19482888 Rgs16 Rat phenobarbital affects expression ISO Rgs16 (Mus musculus) 6480464 Phenobarbital affects the expression of RGS16 mRNA CTD PMID:23091169 Rgs16 Rat phenobarbital affects expression ISO RGS16 (Homo sapiens) 6480464 Phenobarbital affects the expression of RGS16 mRNA CTD PMID:19159669 Rgs16 Rat phenobarbital increases expression ISO Rgs16 (Mus musculus) 6480464 Phenobarbital results in increased expression of RGS16 mRNA CTD PMID:19270015 Rgs16 Rat phenobarbital multiple interactions ISO Rgs16 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of RGS16 mRNA] CTD PMID:19482888 Rgs16 Rat phorbol 13-acetate 12-myristate increases expression ISO RGS16 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of RGS16 mRNA CTD PMID:31068361 Rgs16 Rat phosgene affects expression ISO Rgs16 (Mus musculus) 6480464 Phosgene affects the expression of RGS16 mRNA CTD PMID:16300373 Rgs16 Rat pirinixic acid increases expression ISO Rgs16 (Mus musculus) 6480464 pirinixic acid results in increased expression of RGS16 mRNA CTD PMID:18445702 Rgs16 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of RGS16 mRNA CTD PMID:32741897 Rgs16 Rat pirinixic acid decreases expression ISO Rgs16 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RGS16 mRNA CTD PMID:16221962 more ... Rgs16 Rat pirinixic acid multiple interactions ISO Rgs16 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of RGS16 mRNA] and PPARA protein promotes the reaction [pirinixic acid results in decreased expression of RGS16 mRNA] CTD PMID:16221962 and PMID:20059764 Rgs16 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of RGS16 mRNA CTD PMID:27225895 Rgs16 Rat pravastatin decreases expression ISO Rgs16 (Mus musculus) 6480464 Pravastatin results in decreased expression of RGS16 mRNA CTD PMID:27225895 Rgs16 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Rgs16 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of RGS16 mRNA CTD PMID:28903501 Rgs16 Rat propanal increases expression ISO RGS16 (Homo sapiens) 6480464 propionaldehyde results in increased expression of RGS16 mRNA CTD PMID:26079696 Rgs16 Rat propiconazole decreases expression ISO Rgs16 (Mus musculus) 6480464 propiconazole results in decreased expression of RGS16 mRNA CTD PMID:21278054 Rgs16 Rat protein kinase inhibitor multiple interactions ISO RGS16 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of RGS16 mRNA] CTD PMID:28003376 Rgs16 Rat raloxifene multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in decreased expression of RGS16 mRNA CTD PMID:19059307 Rgs16 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGS16 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of RGS16 mRNA] CTD PMID:35811015 Rgs16 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGS16 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of RGS16 mRNA CTD PMID:35811015 Rgs16 Rat silicon dioxide increases expression ISO RGS16 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of RGS16 mRNA CTD PMID:23806026 and PMID:25895662 Rgs16 Rat silicon dioxide increases expression ISO Rgs16 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of RGS16 mRNA CTD PMID:19073995 and PMID:29341224 Rgs16 Rat silver atom increases expression ISO RGS16 (Homo sapiens) 6480464 Silver results in increased expression of RGS16 mRNA CTD PMID:28959546 Rgs16 Rat silver(0) increases expression ISO RGS16 (Homo sapiens) 6480464 Silver results in increased expression of RGS16 mRNA CTD PMID:28959546 Rgs16 Rat sodium arsenite decreases expression ISO RGS16 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RGS16 mRNA CTD PMID:29301061 Rgs16 Rat sodium arsenite increases expression ISO RGS16 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RGS16 mRNA CTD PMID:38568856 Rgs16 Rat succimer multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of RGS16 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of RGS16 mRNA CTD PMID:21641980 and PMID:26378955 Rgs16 Rat sulfasalazine increases expression ISO Rgs16 (Mus musculus) 6480464 Sulfasalazine results in increased expression of RGS16 mRNA CTD PMID:31830553 Rgs16 Rat sulindac sulfide increases expression ISO RGS16 (Homo sapiens) 6480464 sulindac sulfide results in increased expression of RGS16 mRNA CTD PMID:16184548 Rgs16 Rat sunitinib increases expression ISO RGS16 (Homo sapiens) 6480464 Sunitinib results in increased expression of RGS16 mRNA CTD PMID:31533062 Rgs16 Rat tacrolimus hydrate increases expression ISO Rgs16 (Mus musculus) 6480464 Tacrolimus results in increased expression of RGS16 mRNA CTD PMID:29362864 Rgs16 Rat tamibarotene decreases expression ISO RGS16 (Homo sapiens) 6480464 tamibarotene results in decreased expression of RGS16 mRNA CTD PMID:15498508 Rgs16 Rat tamoxifen multiple interactions ISO RGS16 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR1 protein] results in decreased expression of RGS16 mRNA CTD PMID:19059307 Rgs16 Rat tamoxifen affects expression ISO Rgs16 (Mus musculus) 6480464 Tamoxifen affects the expression of RGS16 mRNA CTD PMID:20937368 Rgs16 Rat tetrachloroethene increases expression ISO Rgs16 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of RGS16 mRNA CTD PMID:28973375 Rgs16 Rat tetrachloromethane decreases expression ISO Rgs16 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of RGS16 mRNA CTD PMID:27339419 Rgs16 Rat tetrachloromethane affects expression ISO Rgs16 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of RGS16 mRNA CTD PMID:31919559 Rgs16 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of RGS16 mRNA CTD PMID:31150632 Rgs16 Rat theophylline increases expression ISO RGS16 (Homo sapiens) 6480464 Theophylline results in increased expression of RGS16 mRNA CTD PMID:16083514 Rgs16 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of RGS16 mRNA CTD PMID:33854195 Rgs16 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of RGS16 mRNA CTD PMID:23411599 Rgs16 Rat thiram increases expression ISO RGS16 (Homo sapiens) 6480464 Thiram results in increased expression of RGS16 mRNA CTD PMID:38568856 Rgs16 Rat titanium dioxide increases expression ISO Rgs16 (Mus musculus) 6480464 titanium dioxide results in increased expression of RGS16 mRNA CTD PMID:21259345 more ... Rgs16 Rat trichloroethene increases expression ISO Rgs16 (Mus musculus) 6480464 Trichloroethylene results in increased expression of RGS16 mRNA CTD PMID:25549359 Rgs16 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of RGS16 mRNA CTD PMID:33387578 Rgs16 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of RGS16 gene CTD PMID:27618143 Rgs16 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of RGS16 mRNA CTD PMID:30589522 Rgs16 Rat Triptolide decreases expression ISO Rgs16 (Mus musculus) 6480464 triptolide results in decreased expression of RGS16 mRNA CTD PMID:32835833 Rgs16 Rat triptonide increases expression ISO Rgs16 (Mus musculus) 6480464 triptonide results in increased expression of RGS16 mRNA CTD PMID:33045310 Rgs16 Rat troglitazone decreases expression ISO Rgs16 (Mus musculus) 6480464 troglitazone results in decreased expression of RGS16 mRNA CTD PMID:28973697 Rgs16 Rat trovafloxacin increases expression ISO Rgs16 (Mus musculus) 6480464 trovafloxacin results in increased expression of RGS16 mRNA CTD PMID:35537566 Rgs16 Rat tunicamycin increases expression ISO RGS16 (Homo sapiens) 6480464 Tunicamycin results in increased expression of RGS16 mRNA CTD PMID:29453283 Rgs16 Rat valproic acid multiple interactions ISO Rgs16 (Mus musculus) 6480464 KDM1A protein affects the reaction [Valproic Acid inhibits the reaction [Dexamethasone results in decreased expression of RGS16 mRNA]] and Valproic Acid inhibits the reaction [Dexamethasone results in decreased expression of RGS16 mRNA] CTD PMID:27645313 Rgs16 Rat valproic acid increases expression ISO RGS16 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RGS16 mRNA CTD PMID:23179753 and PMID:24935251 Rgs16 Rat valproic acid increases expression ISO Rgs16 (Mus musculus) 6480464 Valproic Acid results in increased expression of RGS16 mRNA CTD PMID:27645313 Rgs16 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RGS16 mRNA CTD PMID:23034163 Rgs16 Rat vincristine increases expression ISO RGS16 (Homo sapiens) 6480464 Vincristine results in increased expression of RGS16 mRNA CTD PMID:23649840 Rgs16 Rat zaragozic acid A decreases expression ISO Rgs16 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of RGS16 mRNA CTD PMID:27225895 Rgs16 Rat zaragozic acid A decreases expression EXP 6480464 squalestatin 1 results in decreased expression of RGS16 mRNA CTD PMID:27225895 Rgs16 Rat zinc atom multiple interactions ISO RGS16 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RGS16 mRNA CTD PMID:18593933 Rgs16 Rat zinc atom multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593 Rgs16 Rat zinc(0) multiple interactions ISO RGS16 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RGS16 mRNA CTD PMID:18593933 Rgs16 Rat zinc(0) multiple interactions ISO Rgs16 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of RGS16 mRNA CTD PMID:33549593
(-)-demecolcine (ISO) (S)-colchicine (ISO) 1,2-dimethylhydrazine (ISO) 1-fluoro-2,4-dinitrobenzene (ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acrolein (EXP) acrylamide (ISO) actinomycin D (ISO) adenine (ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsenite(3-) (ISO) atrazine (EXP) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzoates (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) camptothecin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) curcumin (ISO) cyanocob(III)alamin (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diclofenac (ISO) dinophysistoxin 1 (ISO) dioxygen (EXP,ISO) disulfiram (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethyl methanesulfonate (ISO) fenofibrate (EXP) fenthion (ISO) fentin chloride (EXP) ferric oxide (EXP) folic acid (ISO) formaldehyde (ISO) fumonisin B1 (ISO) furan (ISO) genistein (ISO) gentamycin (EXP) glycine betaine (ISO) glyphosate (EXP) hydrogen peroxide (ISO) hydroxyurea (ISO) imidacloprid (EXP) indole-3-methanol (EXP) inulin (ISO) itraconazole (ISO) kainic acid (ISO) ketoconazole (ISO) L-methionine (ISO) Lasiocarpine (ISO) leflunomide (ISO) Licochalcone B (ISO) lipopolysaccharide (EXP,ISO) manganese(II) chloride (EXP) melphalan (ISO) menadione (ISO) methyl methanesulfonate (ISO) methylisothiazolinone (ISO) methylmercury chloride (EXP,ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) N(6)-dimethylallyladenine (ISO) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (EXP,ISO) N-Nitrosopyrrolidine (ISO) naphthalene (ISO) nevirapine (ISO) nickel atom (ISO) nickel sulfate (ISO) Nutlin-3 (ISO) orphenadrine (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) phosgene (ISO) pirinixic acid (EXP,ISO) pravastatin (EXP,ISO) pregnenolone 16alpha-carbonitrile (ISO) propanal (ISO) propiconazole (ISO) protein kinase inhibitor (ISO) raloxifene (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) succimer (ISO) sulfasalazine (ISO) sulindac sulfide (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) tamibarotene (ISO) tamoxifen (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) theophylline (ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (EXP) Triptolide (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) zaragozic acid A (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
Rgs16 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 68,421,480 - 68,443,312 (+) NCBI GRCr8 mRatBN7.2 13 65,887,668 - 65,892,862 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 65,887,530 - 65,892,857 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 68,488,860 - 68,492,298 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 69,779,050 - 69,782,494 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 67,032,029 - 67,035,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 71,163,411 - 71,185,147 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 71,179,910 - 71,185,216 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 76,128,653 - 76,150,399 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 68,807,863 - 68,811,307 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 65,788,298 - 65,791,737 (+) NCBI Celera Cytogenetic Map 13 q21 NCBI
RGS16 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 182,598,623 - 182,604,389 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 182,598,623 - 182,604,389 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 182,567,758 - 182,573,524 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 180,834,381 - 180,840,171 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 179,299,415 - 179,305,200 NCBI Celera 1 155,678,992 - 155,684,782 (-) NCBI Celera Cytogenetic Map 1 q25.3 NCBI HuRef 1 153,804,224 - 153,810,014 (-) NCBI HuRef CHM1_1 1 183,991,292 - 183,997,081 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 181,958,121 - 181,963,886 (-) NCBI T2T-CHM13v2.0
Rgs16 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 153,616,099 - 153,621,212 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 153,616,095 - 153,621,214 (+) Ensembl GRCm39 Ensembl GRCm38 1 153,740,353 - 153,745,468 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 153,740,349 - 153,745,468 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 155,587,483 - 155,592,598 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 155,502,566 - 155,507,684 (+) NCBI MGSCv36 mm8 Celera 1 156,172,183 - 156,177,294 (+) NCBI Celera Cytogenetic Map 1 G3 NCBI cM Map 1 65.43 NCBI
Rgs16 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 21,439,272 - 21,445,038 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 21,439,536 - 21,444,822 (-) NCBI ChiLan1.0 ChiLan1.0
RGS16 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 67,124,524 - 67,130,751 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 66,808,016 - 66,814,241 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 158,117,257 - 158,123,031 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 161,768,921 - 161,774,709 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 161,765,595 - 161,774,709 (-) Ensembl panpan1.1 panPan2
RGS16 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 16,009,283 - 16,015,228 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 16,009,271 - 16,015,597 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 15,595,717 - 15,601,663 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 15,738,716 - 15,744,653 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 15,739,616 - 15,744,690 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 15,650,339 - 15,656,274 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 15,758,624 - 15,764,560 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 15,887,673 - 15,893,854 (-) NCBI UU_Cfam_GSD_1.0
Rgs16 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 89,300,380 - 89,305,804 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 7,147,013 - 7,152,565 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 7,147,147 - 7,152,555 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RGS16 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 123,913,173 - 123,918,871 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 123,913,179 - 123,919,119 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 136,173,524 - 136,175,853 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RGS16 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 46,764,097 - 46,769,895 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 46,764,134 - 46,769,896 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 47,982,051 - 47,987,847 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rgs16
.
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 56 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000032236 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032236 ⟹ ENSRNOP00000029844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 65,887,530 - 65,892,857 (+) Ensembl Rnor_6.0 Ensembl 13 71,179,910 - 71,185,216 (+) Ensembl
RefSeq Acc Id:
NM_001077589 ⟹ NP_001071057
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 68,438,120 - 68,443,312 (+) NCBI mRatBN7.2 13 65,887,668 - 65,892,862 (+) NCBI Rnor_6.0 13 71,180,078 - 71,183,522 (+) NCBI Rnor_5.0 13 76,128,653 - 76,150,399 (+) NCBI RGSC_v3.4 13 68,807,863 - 68,811,307 (+) RGD Celera 13 65,788,298 - 65,791,737 (+) RGD
Sequence:
ATGTGCCGCACCCTAGCCACCTTCCCTAACACCTGCCTGGAAAGAGCCAAAGAGTTCAAGACACGCCTGGGGATCTTTCTTCATAAATCAGAGCTAAGCTCGGATACTGGGGGTAACGGCAAATTCGA
hide sequence
RefSeq Acc Id:
XM_063272477 ⟹ XP_063128547
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 68,421,480 - 68,443,300 (+) NCBI
RefSeq Acc Id:
NP_001071057 ⟸ NM_001077589
- UniProtKB:
P56700 (UniProtKB/Swiss-Prot), Q4L0E9 (UniProtKB/TrEMBL), F7FDE5 (UniProtKB/TrEMBL)
- Sequence:
MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGNGKFEWASKLSKERSFSEDVLGWRESFQSLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000029844 ⟸ ENSRNOT00000032236
RefSeq Acc Id:
XP_063128547 ⟸ XM_063272477
- Peptide Label:
isoform X1
- UniProtKB:
P56700 (UniProtKB/Swiss-Prot), F7FDE5 (UniProtKB/TrEMBL), Q4L0E9 (UniProtKB/TrEMBL)
RGD ID: 13698899 Promoter ID: EPDNEW_R9424 Type: single initiation site Name: Rgs16_1 Description: regulator of G-protein signaling 16 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 71,179,958 - 71,180,018 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2007-04-12
Rgs16
regulator of G-protein signaling 16
Rgs16_mapped
regulator of G-protein signaling 16 (mapped)
Data merged from RGD:3565
737654 APPROVED
2006-11-19
Rgs16_mapped
regulator of G-protein signaling 16(mapped)
Rgs16
regulator of G-protein signaling 16
Symbol set to symbol_mapped, name set to name (mapped)
1582166 APPROVED
2006-11-19
Rgs16
regulator of G-protein signaling 16
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Rgs16
Regulator of G-protein signaling 16
Symbol and Name status set to approved
70586 APPROVED
