Mrpl19 (mitochondrial ribosomal protein L19)

Gene: Mrpl19 (mitochondrial ribosomal protein L19) Rattus norvegicus

Analyze

Symbol:

Mrpl19

Name:

mitochondrial ribosomal protein L19

RGD ID:

1587381

Description:

Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Predicted to be located in mitochondrion and nucleus. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL19 (mitochondrial ribosomal protein L19); INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

39S ribosomal protein L19, mitochondrial; large ribosomal subunit protein bL19m; MRP-L15; Mrpl19_mapped; ribosomal protein, mitochondrial, L15; ribosomal protein, mitochondrial, L15 (mapped); Rpml15

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPL19 (mitochondrial ribosomal protein L19)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Mrpl19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrpl19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPL19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPL19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrpl19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPL19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPL19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrpl19 (mitochondrial ribosomal protein L19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MPHOSPH6 (M-phase phosphoprotein 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPL19 (mitochondrial ribosomal protein L19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrpl19 (mitochondrial ribosomal protein L19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrpl19 (mitochondrial ribosomal protein L19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMG1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	mRpL19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrpl-19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrpl19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	116,079,654 - 116,083,883 (-)	NCBI		GRCr8
mRatBN7.2	4	114,521,824 - 114,526,053 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	114,521,824 - 114,526,053 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	119,977,599 - 119,981,829 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	115,752,779 - 115,757,009 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	114,373,009 - 114,377,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	112,703,041 - 112,707,270 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	112,703,041 - 112,707,270 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	177,390,795 - 177,395,024 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	116,207,542 - 116,211,771 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	103,520,215 - 103,524,444 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxyethyl methacrylate (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

cadmium dichloride (ISO)

caffeine (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

deguelin (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

gallic acid (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

methimazole (EXP)

methoxyacetic acid (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (EXP,ISO)

methylseleninic acid (ISO)

Monobutylphthalate (EXP)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

picoxystrobin (ISO)

propiconazole (ISO)

pyrimidifen (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

translation (IEA)

Cellular Component

mitochondrial large ribosomal subunit (IBA,ISO)

mitochondrion (ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

structural constituent of ribosome (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Information Derived from GenBank Report	RGD, Sept. 2003

Additional References at PubMed

PMID:10942595	PMID:18614015	PMID:25278503	PMID:28892042

Genomics

Comparative Map Data

Mrpl19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	116,079,654 - 116,083,883 (-)	NCBI		GRCr8
mRatBN7.2	4	114,521,824 - 114,526,053 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	114,521,824 - 114,526,053 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	119,977,599 - 119,981,829 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	115,752,779 - 115,757,009 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	114,373,009 - 114,377,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	112,703,041 - 112,707,270 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	112,703,041 - 112,707,270 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	177,390,795 - 177,395,024 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	116,207,542 - 116,211,771 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	103,520,215 - 103,524,444 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

MRPL19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	75,646,783 - 75,662,206 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	75,646,783 - 75,690,851 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	75,873,909 - 75,889,332 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	75,727,417 - 75,742,842 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	75,785,566 - 75,794,512	NCBI
Celera	2	75,705,190 - 75,720,614 (+)	NCBI		Celera
Cytogenetic Map	2	p12	NCBI
HuRef	2	75,611,713 - 75,627,137 (+)	NCBI		HuRef
CHM1_1	2	75,803,237 - 75,818,661 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	75,656,074 - 75,671,496 (+)	NCBI		T2T-CHM13v2.0

Mrpl19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	81,934,807 - 81,942,930 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	81,934,832 - 81,942,939 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	81,957,826 - 81,965,949 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	81,957,851 - 81,965,958 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	81,907,820 - 81,915,943 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	81,923,484 - 81,931,607 (-)	NCBI		MGSCv36	mm8
Celera	6	83,958,923 - 83,966,967 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	35.81	NCBI

Mrpl19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	10,207,232 - 10,213,642 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	10,207,091 - 10,213,685 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPL19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	50,727,870 - 50,740,482 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	50,730,624 - 50,743,153 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	75,718,330 - 75,733,763 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	77,221,799 - 77,237,203 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	77,221,799 - 77,230,295 (+)	Ensembl	panpan1.1		panPan2

MRPL19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	47,690,239 - 47,696,996 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	47,690,228 - 47,696,978 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	47,334,163 - 47,340,910 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	48,553,168 - 48,559,700 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	48,552,610 - 48,559,695 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	47,568,930 - 47,575,432 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	47,633,066 - 47,639,587 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	48,195,682 - 48,202,210 (-)	NCBI		UU_Cfam_GSD_1.0

Mrpl19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	8,923,615 - 8,933,101 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936556	1,804,779 - 1,813,844 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936556	1,804,821 - 1,814,204 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPL19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	67,600,842 - 67,611,441 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	67,604,613 - 67,611,323 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	71,096,990 - 71,103,672 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPL19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	31,587,069 - 31,595,314 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	80,604,797 - 80,613,088 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrpl19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	27,702,598 - 27,708,406 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	27,702,423 - 27,707,798 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrpl19
32 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	126
Count of miRNA genes:	97
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000009308
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	38	11	8
Low											3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001029898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000009308 ⟹ ENSRNOP00000009308

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	114,521,824 - 114,526,053 (-)	Ensembl
Rnor_6.0 Ensembl	4	112,703,041 - 112,707,270 (-)	Ensembl

RefSeq Acc Id:

NM_001029898 ⟹ NP_001025069

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	116,079,654 - 116,083,883 (-)	NCBI
mRatBN7.2	4	114,521,824 - 114,526,053 (-)	NCBI
Rnor_6.0	4	112,703,041 - 112,707,270 (-)	NCBI
Rnor_5.0	4	177,390,795 - 177,395,024 (-)	NCBI
RGSC_v3.4	4	116,207,542 - 116,211,771 (-)	RGD
Celera	4	103,520,215 - 103,524,444 (-)	RGD

Sequence:

show sequence

AAATGGCGGCCTCCATGGCAGAAAGTTGTAGGGTGTCCATGTACCTGGCCTGGAGCTACCGAAT
GGCCAGGCCACGGCTTGCTGCTCTCGCGTCTGATGCCTGCCGTGCCCACACGGGCCCAAGTCGG
TTTCAGAGCACTGGGCCATCCGAGCCCGGTGGGTTCAAGCCGCCGCCGAAACCTGTCATTGTGG
ACCGGCGCCGAGCCCCAGAGGAAGAGAGAAGGTTCCTGAGTCCTGAATTCATCCCTCCAAGGGG
GAGAACAAACCCTCTGAAATTTCAGATAGAAAGAAGAGATATGCTGGACAGGAGAAAGGTGCTT
CCCATTCCAGAGTTCTATGTCGGAAGCATACTGCGCGTCACCACAGCTGACCCCTATGCCAGTG
GGAAAACCAGCCAGTTCCTGGGGATTTGCATCAAGCGATCAGGAAGTGGGCTTGGGGCTACTTT
CACCCTCAGGAACACGATCGAAGGACAAGGTGTGGAGATTTGCTTTGAACTGTATAACCCTCGA
ATCCATGAGATCCAAGTGGTGAAGTTGGAGAAGCGGCTGGATGACAGCCTGCTGTACTTACGGG
ATGCCCTCCCCGAGTACAGCACCTTCGATGTGAATATGAAGCCAGTTCCACTTGAGTCCTGCCA
GGAAGTGCCTGTGAACAAGCTGAAAGTTAAAATGAAGCCAAAGCCGTGGTCTAAACGCTGGGAA
CGTCCGAACTTCAACATTAAAGGGATCAGATTTGATCTTGCTTTAACTGAAGAGCAAATGAAAG
AAGCCCAGAAGTGGAGCAAGCCATGGCTTGAGTTTGATATGATGAGAGAATATGACACTTCAAA
AATTGAAGCTGCATTGTGGGAAGAAATAGAAGCATCAAAGAAGTCTTGATCCTGGGACTGGTGA
ATGGCCCAAGAGGTGAACATGCTTGTTGCTCATGAGGCCTGAATTCGACTCTGGAGCCGAGGGT
GGAAGGAGAATACTGACTCCTAAAGTTGCCCTCTGGCCTCTACATGCACACCCTTGCATACATG
GACCGCAATGCCTTTGATGTACTGGCTCTAAGGATTTGGTTTGAAAGCCATTAGGTTTGCTTTC
TAAGAACACAGTGATTAAAAATGAGCATTCGCCCCTTTTCAGTACCTATCATAAAGTCTGTACG
TCAGTTTATTCCTCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001025069	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91090	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009308
	ENSRNOP00000009308.4

RefSeq Acc Id:

NP_001025069 ⟸ NM_001029898

- UniProtKB:

D4A4A9 (UniProtKB/TrEMBL), A6IAH2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAASMAESCRVSMYLAWSYRMARPRLAALASDACRAHTGPSRFQSTGPSEPGGFKPPPKPVIVD
RRRAPEEERRFLSPEFIPPRGRTNPLKFQIERRDMLDRRKVLPIPEFYVGSILRVTTADPYASG
KTSQFLGICIKRSGSGLGATFTLRNTIEGQGVEICFELYNPRIHEIQVVKLEKRLDDSLLYLRD
ALPEYSTFDVNMKPVPLESCQEVPVNKLKVKMKPKPWSKRWERPNFNIKGIRFDLALTEEQMKE
AQKWSKPWLEFDMMREYDTSKIEAALWEEIEASKKS

hide sequence

RefSeq Acc Id:

ENSRNOP00000009308 ⟸ ENSRNOT00000009308

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4A9-F1-model_v2	AlphaFold	D4A4A9	1-292	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693158

Promoter ID:

EPDNEW_R3682

Type:

multiple initiation site

Name:

Mrpl19_1

Description:

mitochondrial ribosomal protein L19

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	112,707,274 - 112,707,334	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1587381	AgrOrtholog
BioCyc Gene	G2FUF-44054	BioCyc
Ensembl Genes	ENSRNOG00000006968	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009308	ENTREZGENE
	ENSRNOT00000009308.6	UniProtKB/TrEMBL
Gene3D-CATH	2.30.30.790	UniProtKB/TrEMBL
InterPro	L19_sf	UniProtKB/TrEMBL
	Ribosomal_L19	UniProtKB/TrEMBL
	Translation_prot_SH3-like	UniProtKB/TrEMBL
KEGG Report	rno:297372	UniProtKB/TrEMBL
NCBI Gene	297372	ENTREZGENE
PANTHER	39S RIBOSOMAL PROTEIN L19, MITOCHONDRIAL	UniProtKB/TrEMBL
	Ribosomal_L19	UniProtKB/TrEMBL
Pfam	Ribosomal_L19	UniProtKB/TrEMBL
PhenoGen	Mrpl19	PhenoGen
PRINTS	RIBOSOMALL19	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006968	RatGTEx
Superfamily-SCOP	Transl_SH3_like	UniProtKB/TrEMBL
UniProt	A6IAH2	ENTREZGENE, UniProtKB/TrEMBL
	D4A4A9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Mrpl19	mitochondrial ribosomal protein L19	Mrpl19	ribosomal protein, mitochondrial, L15	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-04-13	Mrpl19	ribosomal protein, mitochondrial, L15	Mrpl19_mapped	ribosomal protein, mitochondrial, L15 (mapped)	Data merged from RGD:621009	737654	APPROVED
2006-11-19	Mrpl19	ribosomal protein, mitochondrial, L15			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	Mrpl19_mapped	ribosomal protein, mitochondrial, L15(mapped)	Mrpl19	ribosomal protein, mitochondrial, L15	Symbol set to symbol_mapped, name set to name (mapped)	1582166	APPROVED
2004-09-10	Mrpl19	ribosomal protein, mitochondrial, L15	Rpml15		Symbol and Name updated	1299863	APPROVED
2002-08-07	Rpml15	ribosomal protein, mitochondrial, L15			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD