Advanced Search (OLGA)

Gene: Slc25a33 (solute carrier family 25 member 33) Rattus norvegicus

Analyze

Symbol:

Slc25a33

Name:

solute carrier family 25 member 33

RGD ID:

1583942

Description:

Predicted to enable pyrimidine nucleotide transmembrane transporter activity. Predicted to be involved in several processes, including cellular response to peptide hormone stimulus; mitochondria-nucleus signaling pathway; and mitochondrion organization. Predicted to be located in mitochondrial membrane. Orthologous to human SLC25A33 (solute carrier family 25 member 33); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding (Ensembl: pseudogene)

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC691431; LOC691431; similar to mitochondrial carrier protein MGC4399; solute carrier family 25 (pyrimidine nucleotide carrier), member 33; solute carrier family 25, member 33

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC25A33 (solute carrier family 25 member 33)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Slc25a33 (solute carrier family 25, member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc25a33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC25A33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC25A33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc25a33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC25A33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC25A33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc25a33 (solute carrier family 25 member 33)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC25A36 (solute carrier family 25 member 36)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Slc25a33 (solute carrier family 25, member 33)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC25A33 (solute carrier family 25 member 33)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc25a33 (solute carrier family 25 member 33)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T09F3.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RIM2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rim2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	165,478,070 - 165,518,186 (-)	NCBI		GRCr8
mRatBN7.2	5	160,195,040 - 160,219,961 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	160,195,042 - 160,219,961 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	162,911,641 - 162,936,550 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	164,731,772 - 164,756,780 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	164,688,121 - 164,713,130 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	166,701,463 - 166,726,794 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	166,701,465 - 166,726,794 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	170,345,877 - 170,371,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	166,836,557 - 166,861,525 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	158,464,162 - 158,489,066 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease type 2 (ISO)

chromosome 1p36 deletion syndrome (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butanal (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chrysene (ISO)

clobetasol (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

diclofenac (ISO)

dioxygen (ISO)

diuron (EXP)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glutathione (EXP)

glyphosate (ISO)

leflunomide (EXP,ISO)

mercury dichloride (EXP)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

pirinixic acid (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tributylstannane (ISO)

trichloroethene (EXP,ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to insulin stimulus (ISO)

cellular response to insulin-like growth factor stimulus (ISO)

mitochondria-nucleus signaling pathway (ISO)

mitochondrial genome maintenance (ISO)

mitochondrial respiratory chain complex III assembly (ISO)

mitochondrial transcription (ISO)

mitochondrion organization (ISO)

positive regulation of cell growth (ISO)

positive regulation of cell population proliferation (ISO)

pyrimidine nucleotide import into mitochondrion (ISO)

pyrimidine nucleotide transport (ISO)

regulation of mitochondrial membrane potential (ISO)

regulation of oxidative phosphorylation (ISO)

regulation of reactive oxygen species biosynthetic process (ISO)

Cellular Component

mitochondrial membrane (ISO)

mitochondrion (ISO)

Molecular Function

pyrimidine nucleotide transmembrane transporter activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17596519	PMID:18614015	PMID:20453889	PMID:25320081	PMID:34800366

Genomics

Comparative Map Data

Slc25a33
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	165,478,070 - 165,518,186 (-)	NCBI		GRCr8
mRatBN7.2	5	160,195,040 - 160,219,961 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	160,195,042 - 160,219,961 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	162,911,641 - 162,936,550 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	164,731,772 - 164,756,780 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	164,688,121 - 164,713,130 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	166,701,463 - 166,726,794 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	166,701,465 - 166,726,794 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	170,345,877 - 170,371,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	166,836,557 - 166,861,525 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	158,464,162 - 158,489,066 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

SLC25A33
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	9,539,465 - 9,585,173 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	9,539,465 - 9,585,173 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	9,599,524 - 9,645,231 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	9,522,115 - 9,565,418 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	8,705,513 - 8,748,776 (+)	NCBI		Celera
Cytogenetic Map	1	p36.22	NCBI
HuRef	1	8,749,879 - 8,793,232 (+)	NCBI		HuRef
CHM1_1	1	9,588,092 - 9,631,383 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	9,075,801 - 9,121,512 (+)	NCBI		T2T-CHM13v2.0

Slc25a33
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	149,828,493 - 149,858,746 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	149,828,493 - 149,858,734 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	149,744,036 - 149,774,267 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	149,744,036 - 149,774,277 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	149,118,145 - 149,148,376 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	148,588,275 - 148,617,987 (-)	NCBI		MGSCv36	mm8
Celera	4	152,010,383 - 152,042,111 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	80.15	NCBI

Slc25a33
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	3,905,001 - 3,921,505 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	3,905,001 - 3,921,501 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC25A33
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	218,645,042 - 218,687,967 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	217,289,679 - 217,332,623 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	8,300,384 - 8,343,270 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	9,493,787 - 9,574,549 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	9,541,918 - 9,574,549 (+)	Ensembl	panpan1.1		panPan2

SLC25A33
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	62,790,116 - 62,825,644 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	62,790,157 - 62,825,388 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	62,805,827 - 62,841,429 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	63,016,611 - 63,052,345 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	63,016,605 - 63,051,965 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	63,038,606 - 63,074,205 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	62,877,358 - 62,913,252 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	63,281,618 - 63,317,240 (+)	NCBI		UU_Cfam_GSD_1.0

Slc25a33
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	33,096,589 - 33,118,280 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936623	3,585,253 - 3,604,310 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936623	3,585,372 - 3,603,515 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC25A33
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	69,934,834 - 69,969,084 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	69,934,810 - 69,969,091 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	64,148,523 - 64,168,519 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC25A33
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	122,187,366 - 122,220,903 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	122,187,637 - 122,220,661 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	26,153,642 - 26,197,329 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc25a33
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	2,835,649 - 2,868,692 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	2,838,700 - 2,868,672 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc25a33
362 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	24
Interacting mature miRNAs:	24
Transcripts:	ENSRNOT00000022799
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022799 ⟹ ENSRNOP00000022799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	160,195,042 - 160,219,961 (-)	Ensembl
Rnor_6.0 Ensembl	5	166,701,465 - 166,726,794 (-)	Ensembl

RefSeq Acc Id:

NM_001127574 ⟹ NP_001121046

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,478,070 - 165,502,973 (-)	NCBI
mRatBN7.2	5	160,195,040 - 160,219,961 (-)	NCBI
Rnor_6.0	5	166,701,463 - 166,726,794 (-)	NCBI
Rnor_5.0	5	170,345,877 - 170,371,208 (-)	NCBI
RGSC_v3.4	5	166,836,557 - 166,861,525 (-)	RGD
Celera	5	158,464,162 - 158,489,066 (-)	RGD

Sequence:

show sequence

CTGGCCGGCCGCGACGCCGCGGAGGTAGCCGGGCGCCTGGGCCTCCCGCGCGCATGGAAGCGTC
CGCGGCTGCCTGAGGAGGGCAGCGAGGCCAGCGGACCTCGAGACCTCGCGCGTCCCACGAGCGG
CTGCGGCGGGCCGCGGAGCCGGCGCGGCCATGGCGACGGACACTCAGCAGAAGGAGAACACGCT
GCTTCATCTCTTCGCCGGCGGGTGTGGAGGTACAGTTGGTGCTATTTTCACATGTCCACTAGAA
GTCATTAAGACGAGACTGCAGTCTTCGAGACTAGCTCTTCGGACGGTGTATTATCCTCAGGTTC
ATCTGGGGACCATTAGTGGAGCTGGAATGGTGAGACCAACGTCTGTGACGCCTGGACTCCTACA
GGTTCTGAAATCGATCCTGGAAAAGGAGGGACCAAAGTCACTCTTTAGAGGCTTGGGTCCAAAC
TTGGTTGGAGTTGCGCCATCCAGGGCTGTGTACTTCGCGTGCTACTCCAAAGCCAAAGAGCAGT
TCAATGGCATCTTCGTGCCTGATAGCAACACTGTGCACATTTTCTCAGCTGGCTCTGCAGCTTT
TGTCACAAATACCTTAATGAATCCTATTTGGATGGTTAAAACGAGGATGCAGCTAGAACGAAAG
ATGAGAGGCTGCAAGCAGATGAATACCCTCCAGTGTGCTCGGCACGTGTACCAGACAGAAGGCA
TCCGTGGCTTCTACAGAGGGCTGACCGCCTCCTATGCTGGCATCTCAGAGACAATCATCTGCTT
TGCTCTCTATGAGAGTTTAAAGAAGTGCTTAAAAGAAGCCCCGATAGTCTCCTCCACGGACGGA
ACGGAGAAAAGTTCCTCCAACTTCTTTGGACTGATGGCGGCTGCTGCTGTTTCTAAGGGGTGCG
CCTCCTGCATTGCTTACCCGCACGAGGTCATCAGGACACGGCTCCGGGAAGAAGGCAGCAAGTA
CACGTCATTCATGCAGACAGCACGCCTGGTATTCCGGGAGGAAGGCTATCTCGCCTTCTACCGA
GGACTTTTTGCTCAGCTCATCCGGCAGATCCCCAATACTGCCATTGTCCTGTCCACCTACGAGT
TCATCGTGTACCTGCTGGGAGAGCGCGCTTAGTGACAGGGCCACACAGTTGTGCTCTAGAAGAA
TAAAACTGAAAACCCTAGAGATTTTCTTTTCCGTTAATGTTTAGTGTTCAAAACTGAAACAGCA
AGGCCATAGAATACCCGGCTCGTGTCACCTGTTGGACATTTCCTTTTGGATTCATGTTTCTGGA
AGGTTTAAATTCATTAACGTTAATAGTTAATTATAACTTTCTTTTTTAACTTAAGAGGATTGAG
GATTAAGCAGCAAGTAAATTAAATCATGCTATTTAATTTAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063288452 ⟹ XP_063144522

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,478,070 - 165,518,186 (-)	NCBI

RefSeq Acc Id:

XM_063288453 ⟹ XP_063144523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,478,070 - 165,518,173 (-)	NCBI

RefSeq Acc Id:

XM_063288454 ⟹ XP_063144524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,478,070 - 165,502,798 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001121046	(Get FASTA)	NCBI Sequence Viewer
	XP_063144522	(Get FASTA)	NCBI Sequence Viewer
	XP_063144523	(Get FASTA)	NCBI Sequence Viewer
	XP_063144524	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67066	(Get FASTA)	NCBI Sequence Viewer
	EDL81173	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001121046 ⟸ NM_001127574

- UniProtKB:

B2RZ89 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATDTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGM
VRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPDSN
TVHIFSAGSAAFVTNTLMNPIWMVKTRMQLERKMRGCKQMNTLQCARHVYQTEGIRGFYRGLTA
SYAGISETIICFALYESLKKCLKEAPIVSSTDGTEKSSSNFFGLMAAAAVSKGCASCIAYPHEV
IRTRLREEGSKYTSFMQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA

hide sequence

Ensembl Acc Id:

ENSRNOP00000022799 ⟸ ENSRNOT00000022799

RefSeq Acc Id:	XP_063144522 ⟸ XM_063288452
- Peptide Label:	isoform X1
- UniProtKB:	B2RZ89 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144523 ⟸ XM_063288453
- Peptide Label:	isoform X1
- UniProtKB:	B2RZ89 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144524 ⟸ XM_063288454
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ89-F1-model_v2	AlphaFold	B2RZ89	1-320	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694276

Promoter ID:

EPDNEW_R4801

Type:

multiple initiation site

Name:

Slc25a33_1

Description:

solute carrier family 25 member 33

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	166,726,806 - 166,726,866	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583942	AgrOrtholog
BioCyc Gene	G2FUF-39116	BioCyc
Ensembl Genes	ENSRNOG00000016949	Ensembl
Gene3D-CATH	1.50.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8376338	IMAGE-MGC_LOAD
InterPro	Mitochondrial_sb/sol_carrier	UniProtKB/TrEMBL
	Mt_carrier_dom	UniProtKB/TrEMBL
	SLC25A33/36-like	UniProtKB/TrEMBL
KEGG Report	rno:691431	UniProtKB/TrEMBL
MGC_CLONE	MGC:189383	IMAGE-MGC_LOAD
NCBI Gene	691431	ENTREZGENE
PANTHER	MITOCHONDRIAL CARRIER PROTEIN RIM2	UniProtKB/TrEMBL
	SOLUTE CARRIER FAMILY 25 MEMBER 33	UniProtKB/TrEMBL
Pfam	Mito_carr	UniProtKB/TrEMBL
PhenoGen	Slc25a33	PhenoGen
PROSITE	SOLCAR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016949	RatGTEx
Superfamily-SCOP	Mitoch_carrier	UniProtKB/TrEMBL
UniProt	B2RZ89	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc25a33	solute carrier family 25 member 33	Slc25a33	solute carrier family 25 (pyrimidine nucleotide carrier), member 33	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Slc25a33	solute carrier family 25 (pyrimidine nucleotide carrier), member 33	Slc25a33	solute carrier family 25, member 33	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-01-19	Slc25a33	solute carrier family 25, member 33	Slc25a33	solute carrier family 25, member 33	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-11-30	Slc25a33	solute carrier family 25, member 33	LOC691431	similar to mitochondrial carrier protein MGC4399	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC691431	similar to mitochondrial carrier protein MGC4399	LOC686808	similar to mitochondrial carrier protein MGC4399	Data merged from RGD:1592540	1643240	APPROVED
2006-11-20	LOC686808	similar to mitochondrial carrier protein MGC4399			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC691431	similar to mitochondrial carrier protein MGC4399			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar