Advanced Search (OLGA)

Gene: Azin2 (antizyme inhibitor 2) Rattus norvegicus

Analyze

Symbol:

Azin2

Name:

antizyme inhibitor 2

RGD ID:

1564776

Description:

Predicted to enable ornithine decarboxylase activator activity. Predicted to be involved in several processes, including positive regulation of polyamine transmembrane transport; putrescine biosynthetic process from ornithine; and trans-Golgi network membrane organization. Predicted to act upstream of or within ornithine metabolic process. Located in granular vesicle and nucleus. Orthologous to human AZIN2 (antizyme inhibitor 2); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

Adc; arginine decarboxylase; AzI2; hypothetical protein LOC366473; LOC366473; LOC500550; ODC-p; ornithine decarboxylase paralog; RGD1564776; similar to ornithine decarboxylase-like protein; uncharacterized protein LOC366473

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AZIN2 (antizyme inhibitor 2)	HGNC	Ensembl, HomoloGene, NCBI
Mus musculus (house mouse):	Azin2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Azin2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AZIN2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AZIN2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Azin2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AZIN2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AZIN2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Azin2 (antizyme inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NLRP4 (NLR family pyrin domain containing 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	AZIN2 (antizyme inhibitor 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Azin2 (antizyme inhibitor 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Odc1	Alliance	DIOPT (Hieranoid\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SPE1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	odc-1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	azin2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	146,568,187 - 146,594,777 (-)	NCBI		GRCr8
mRatBN7.2	5	141,281,310 - 141,310,415 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	141,281,249 - 141,310,397 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	143,981,604 - 144,008,307 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	145,751,428 - 145,778,134 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	145,751,282 - 145,777,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	147,120,128 - 147,148,576 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	147,120,129 - 147,148,291 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	150,852,122 - 150,878,525 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	148,100,546 - 148,110,453 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	139,766,112 - 139,793,390 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

choline (ISO)

cisplatin (ISO)

clothianidin (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

folic acid (ISO)

indometacin (ISO)

L-methionine (ISO)

lead nitrate (EXP)

lipopolysaccharide (ISO)

methoxychlor (EXP)

orphenadrine (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of protein catabolic process (IBA,IEA,ISO,ISS)

ornithine metabolic process (ISO)

polyamine biosynthetic process (IEA)

positive regulation of catalytic activity (ISO,ISS)

positive regulation of polyamine transmembrane transport (IBA,ISO,ISS)

putrescine biosynthetic process from arginine, via ornithine (IBA)

trans-Golgi network membrane organization (IEA,ISO,ISS)

Cellular Component

axon (IEA,ISO,ISS)

cis-Golgi network (ISO,ISS)

cytoplasm (IBA)

cytoplasmic vesicle (ISO,ISS)

cytosol (IEA,ISO)

dendrite (IEA,ISO,ISS)

endoplasmic reticulum-Golgi intermediate compartment membrane (ISO,ISS)

granular vesicle (IDA,IEA,ISO)

mitochondrion (ISO)

nucleus (IDA,IEA,ISO)

perikaryon (IEA,ISO,ISS)

perinuclear region of cytoplasm (IEA,ISO,ISS)

trans-Golgi network (IEA,ISO,ISS)

transport vesicle (IEA,ISO,ISS)

Molecular Function

arginine decarboxylase activity (ISO)

catalytic activity (IEA)

ornithine decarboxylase activator activity (IBA,IEA,ISO,ISS)

ornithine decarboxylase activity (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of antizyme inhibitor 2 in mast cells and role of polyamines as selective regulators of serotonin secretion.	Kanerva K, etal., PLoS One. 2009 Aug 31;4(8):e6858. doi: 10.1371/journal.pone.0006858.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16445852	PMID:16916800	PMID:17900240	PMID:18508777	PMID:19449338	PMID:19832840	PMID:19956990	PMID:20188728	PMID:24967154	PMID:27565891	PMID:29584819
PMID:30566531

Genomics

Comparative Map Data

Azin2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	146,568,187 - 146,594,777 (-)	NCBI		GRCr8
mRatBN7.2	5	141,281,310 - 141,310,415 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	141,281,249 - 141,310,397 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	143,981,604 - 144,008,307 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	145,751,428 - 145,778,134 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	145,751,282 - 145,777,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	147,120,128 - 147,148,576 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	147,120,129 - 147,148,291 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	150,852,122 - 150,878,525 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	148,100,546 - 148,110,453 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	139,766,112 - 139,793,390 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

AZIN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	33,081,153 - 33,166,795 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	33,081,104 - 33,123,492 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	33,546,754 - 33,589,093 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	33,319,301 - 33,358,582 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	31,816,917 - 31,856,199 (+)	NCBI		Celera
Cytogenetic Map	1	p35.1	NCBI
HuRef	1	31,662,672 - 31,701,953 (+)	NCBI		HuRef
CHM1_1	1	33,662,239 - 33,701,504 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	32,941,046 - 33,025,345 (+)	NCBI		T2T-CHM13v2.0

Azin2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	128,824,026 - 128,856,250 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	128,824,026 - 128,856,235 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	128,930,233 - 128,962,456 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	128,930,233 - 128,962,442 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	128,609,390 - 128,639,661 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	128,434,450 - 128,464,721 (-)	NCBI		MGSCv36	mm8
Celera	4	127,269,823 - 127,300,290 (-)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	62.48	NCBI

Azin2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	11,303,499 - 11,330,555 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	11,304,345 - 11,330,370 (+)	NCBI	ChiLan1.0	ChiLan1.0

AZIN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	193,707,944 - 193,747,394 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	192,830,125 - 192,869,587 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	32,365,430 - 32,404,880 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	33,550,140 - 33,629,953 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	33,550,140 - 33,589,402 (+)	Ensembl	panpan1.1		panPan2

AZIN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	68,288,554 - 68,323,710 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	68,286,195 - 68,323,710 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	64,868,938 - 64,903,660 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	68,852,964 - 68,887,963 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	68,853,095 - 68,887,963 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	65,665,607 - 65,700,276 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	66,688,183 - 66,722,680 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	67,680,112 - 67,714,721 (-)	NCBI		UU_Cfam_GSD_1.0

Azin2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	50,116,873 - 50,148,699 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	15,941,620 - 15,973,745 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	15,941,655 - 15,973,481 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AZIN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	89,345,862 - 89,385,319 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	89,346,860 - 89,385,323 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	83,490,513 - 83,529,154 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AZIN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	99,757,861 - 99,804,671 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	16,893,178 - 16,935,047 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Azin2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	16,145,308 - 16,175,000 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	16,145,696 - 16,177,588 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Azin2
187 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

RH139801

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	146,592,871 - 146,593,068 (+)	Marker Load Pipeline
mRatBN7.2	5	141,308,491 - 141,308,688 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	147,146,671 - 147,146,867	NCBI	Rnor6.0
Rnor_5.0	5	150,876,905 - 150,877,101	UniSTS	Rnor5.0
Celera	5	139,791,485 - 139,791,681	UniSTS
RH 3.4 Map	5	957.2	UniSTS
Cytogenetic Map	5	q36	UniSTS

BB398156

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	141,283,502 - 141,283,822 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	147,119,831 - 147,120,150	NCBI	Rnor6.0
Rnor_5.0	5	150,851,825 - 150,852,144	UniSTS	Rnor5.0
Celera	5	139,765,815 - 139,766,134	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	85	84	53	25	53	6	212	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK470797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HQ413774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080340 ⟹ ENSRNOP00000074775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	141,283,801 - 141,310,397 (-)	Ensembl
Rnor_6.0 Ensembl	5	147,120,335 - 147,147,615 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085151 ⟹ ENSRNOP00000072209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	141,281,354 - 141,310,397 (-)	Ensembl
Rnor_6.0 Ensembl	5	147,120,129 - 147,148,291 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097734 ⟹ ENSRNOP00000089341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	141,281,249 - 141,310,397 (-)	Ensembl

RefSeq Acc Id:

NM_001014261 ⟹ NP_001014283

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	146,568,187 - 146,594,777 (-)	NCBI
mRatBN7.2	5	141,283,800 - 141,310,397 (-)	NCBI
Rnor_6.0	5	147,120,128 - 147,148,576 (-)	NCBI
Rnor_5.0	5	150,852,122 - 150,878,525 (-)	NCBI
RGSC_v3.4	5	148,100,546 - 148,110,453 (-)	ENTREZGENE
Celera	5	139,766,112 - 139,793,390 (-)	NCBI

Sequence:

show sequence

CTGCTGGGCGCGCGGGGCGCAGGCCGCGGGGCCGGAGCCGGGGGGAGCGAGCGAGCGGAGGCGC
CGAGGATCCGATTCACTCGCTGGGGAGACCTATGGGCCGAAGCCGTGTAAATGCGTTTTAAGCA
GGGGCCTCGGCTCCGCAACTGCCACTCCTCCTCGGGGTGTTGCACAAGTTTCGAGGTCACCGGC
GACCCCCCCTAGCAGCGCGCCTGGCTCTGGCCCCCGCGAAGGAGGACGGGGCTTGTGTGTTGCA
TACTTTCTAAGGCGGTGGCCAAGGCAGCCAGCGGTGCTCCAAGGCAGCAGTTTCATCCAGCCCC
TGGGCTCCCCCTGCTCAGCATGGCTGGCTACCTCAGTGAATCGGACTTTGTGATGGTGGAGGAG
GGCTTCAGCACCCGGGATCTGCTGGAGGAACTCACTCTGGGGGCCTCCCAGGCCACCACGGGCA
AGGTGGCTGCCTTCTTCGTGGCCGACCTGGGTGCTGTAGTGAGGAAGCACTTCTGCTTTCTGAA
GTACCTGCCTCGAGTCCGGCCTTTTTATGCTGTCAGGTGCAACAGCAGTCTTGGCGTGCTGAAG
GTCCTGGCCGAGCTGGGACTGGGCTTCAGCTGTGCCAGCAAGGCAGAGATGGAGTTGGTCCAGC
ACATTGGTGTCCCTGCCAGTAAGATCATCTGTGCCAACCCCTGTAAGCAAGTTGCCCAGATCAA
GTATGCTGCCAAGCACGGGGTGAGACTGCTAAGCTTCGACAATGAAGTGGAACTGGCCAAGGTG
GTCAAGAGCCACCCCAGTGCCAAGATGGTTCTGTGCATTGCTACCCAGGACTCCCACTCTCTGA
ATCACCTGAGCTTGAGGTTCGGGGCGTCGCTGAAATCCTGCAGACATCTGCTCGAGAACGCCAA
GCAGAGCCATGTGGAGGTGGTGGGTGTGAGTTTTCACATTGGTAGTGGCTGTCCTGACCCTCAG
GCCTATGCCCAGTCCATCGCGGATGCCAGGCTCGTGTTTCAAATGGGTGCGGAGCTGGGCCACA
CGATGAACATCCTGGACCTTGGCGGCGGCTTTCCTGGCTTAGAGGGAGCCAAAGTGAGATTTGA
AGAGATGGCCTCAGTGATTAACTCAGCCTTGGACCTGTACTTCCCTGAGGGCTGCGGTGTGGAC
ATCCTTGCTGAGCTGGGCCGCTACTATGTGACGTCAGCCTTCACTGTGGCCGTCAGCATCGTTG
CCAAGAAGGAGGTTCTGGACCAGCCCAGCAGGGAGGAGCAAACCGGCGCAGCCCCTAAGAGCAT
CGTGTACCACCTTGATGAAGGTGTTTATGGGGTCTTCAACTCAGTCCTGTTTGACAACACCTGC
CCCACCCCCGCCCTGCAGAAGAAACCATCTGCGGATCAACCGCTGTACAGCAGTAGCCTGTGGG
GCCCAGCAGTTGACGGCTGCGACTGTGTGGCTGAGGGCCTATGGCTGCCGCAACTACAAGTAGG
GGACTGGCTGGTCTTTGACAACATGGGTGCTTACACCGTGGACACAAAGTCCCTTCTCGGGGGG
ACCCAGGCCTGCAGAGTCACTTATGCCATGTCCCGGCTAGCCTGGGAAGCCCTTCAAGGGCAGC
TGCTGCCTGCAGAAGAAGACCAGGACGCCGAGGGTGTGTGCAAACCTCTGTCCTGCGGCTGGGA
GATCACAGACAGCCTGTGTGTGGGCCCTGTCTTCACCCCAGCAAGCATCATGTGAGTGGGCCTG
CTTTCCCAGAGAATCCCAGCGGGGCCAAGGAGATGCCTCCGGAGAGGTGGGCGAGGCAGCGAGC
TGGTACCCTCTGGCCAGGACTCTGGTGCTCGCTCTGCCGCCCCACGCTCCACCTGTAGTGTTTC
TGCCCTGTAAATAGGACCAGTCTTACACTCGCTGTAGTTCAAGTATGCAACATAAATCCTGTCC
CTTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014283	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78981	(Get FASTA)	NCBI Sequence Viewer
	ADT63774	(Get FASTA)	NCBI Sequence Viewer
	D4A693	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072209.2
	ENSRNOP00000074775.2
	ENSRNOP00000089341.1

RefSeq Acc Id:

NP_001014283 ⟸ NM_001014261

- UniProtKB:

A6ISG5 (UniProtKB/TrEMBL), F5A6B1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATTGKVAAFFVADLGAVVRKHFCFLKYLPRVR
PFYAVRCNSSLGVLKVLAELGLGFSCASKAEMELVQHIGVPASKIICANPCKQVAQIKYAAKHG
VRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLKSCRHLLENAKQSHVEV
VGVSFHIGSGCPDPQAYAQSIADARLVFQMGAELGHTMNILDLGGGFPGLEGAKVRFEEMASVI
NSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKKEVLDQPSREEQTGAAPKSIVYHLDE
GVYGVFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAVDGCDCVAEGLWLPQLQVGDWLVFD
NMGAYTVDTKSLLGGTQACRVTYAMSRLAWEALQGQLLPAEEDQDAEGVCKPLSCGWEITDSLC
VGPVFTPASIM

hide sequence

Ensembl Acc Id:

ENSRNOP00000074775 ⟸ ENSRNOT00000080340

Ensembl Acc Id:

ENSRNOP00000072209 ⟸ ENSRNOT00000085151

Ensembl Acc Id:

ENSRNOP00000089341 ⟸ ENSRNOT00000097734

Protein Domains

Orn/DAP/Arg decarboxylase 2 C-terminal Orn/DAP/Arg decarboxylase 2 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A693-F1-model_v2	AlphaFold	D4A693	1-457	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564776	AgrOrtholog
BioCyc Gene	G2FUF-39830	BioCyc
Ensembl Genes	ENSRNOG00000051507	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000080340.2	UniProtKB/TrEMBL
	ENSRNOT00000085151.2	UniProtKB/TrEMBL
	ENSRNOT00000097734.1	UniProtKB/TrEMBL
Gene3D-CATH	3.20.20.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7112100	IMAGE-MGC_LOAD
InterPro	Ala_racemase/Decarboxylase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	De-COase2_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	De-COase2_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	De-COase2_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orn/DAP/Arg_de-COase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orn_de-COase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLP-binding_barrel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:366473	UniProtKB/TrEMBL
MGC_CLONE	MGC:93870	IMAGE-MGC_LOAD
NCBI Gene	Azin2	ENTREZGENE
PANTHER	PTHR11482	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11482:SF4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Orn_Arg_deC_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orn_DAP_Arg_deC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Azin2	PhenoGen
PRINTS	ODADCRBXLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ORNDCRBXLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ODR_DC_2_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000051507	RatGTEx
Superfamily-SCOP	SSF50621	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51419	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K2E2_RAT	UniProtKB/TrEMBL
	A0A0G2K8X7_RAT	UniProtKB/TrEMBL
	A0A8I6ABI6_RAT	UniProtKB/TrEMBL
	A6ISG5	ENTREZGENE, UniProtKB/TrEMBL
	AZIN2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	F5A6B1	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYN0_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-06-11	Azin2	antizyme inhibitor 2	Azin2	antizyme inhibitor 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-12	Adc	arginine decarboxylase	RGD1564776	similar to ornithine decarboxylase-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-09-08	RGD1564776	similar to ornithine decarboxylase-like protein	LOC366473	similar to ornithine decarboxylase-like protein	Data merged from RGD:1359637	737654	APPROVED
2008-04-30	RGD1564776	similar to ornithine decarboxylase-like protein	RGD1564776_predicted	similar to ornithine decarboxylase-like protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564776_predicted	similar to ornithine decarboxylase-like protein (predicted)	LOC500550	similar to ornithine decarboxylase-like protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500550	similar to ornithine decarboxylase-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-07-29	LOC366473	similar to ornithine decarboxylase-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar