Advanced Search (OLGA)

Gene: Rnf227 (ring finger protein 227) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rnf227

Name:

ring finger protein 227

RGD ID:

1563441

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in protein ubiquitination. Orthologous to human RNF227 (ring finger protein 227); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cefaloridine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC497935; LOC497935; RGD1563441; similar to RIKEN cDNA A030009H04; uncharacterized protein LOC497935

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RNF227 (ring finger protein 227)	HGNC	Ensembl, OMA
Mus musculus (house mouse):	Rnf227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RNF227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RNF227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnf227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RNF227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RNF227 (ring finger protein 227)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CSTA (cystatin A)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rnf227 (ring finger protein 227)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-335l21.4	Alliance	DIOPT (Hieranoid\|PhylomeDB)
Homo sapiens (human):	RNF227 (ring finger protein 227)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C06A5.8	Alliance	DIOPT (OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	Y51F10.2	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,559,862 - 54,561,823 (+)	NCBI		GRCr8
mRatBN7.2	10	54,061,054 - 54,063,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,059,947 - 54,063,010 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,722,733 - 58,723,405 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,211,347 - 58,212,019 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,719,493 - 53,720,165 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,940,533 - 55,941,205 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,940,533 - 55,941,205 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,681,368 - 55,684,924 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,133,424 - 56,134,096 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	53,217,612 - 53,218,284 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf227	Rat	Diamond-Blackfan anemia		ISO	RGD:13434539	8554872	ClinVar Annotator: match by term: Diamond-Blackfan anemia	ClinVar	PMID:20522432\|PMID:21056402\|PMID:22267198\|PMID:22387016\|PMID:23172776\|PMID:28492532
Rnf227	Rat	dyskeratosis congenita		ISO	RGD:13434539	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita	ClinVar	PMID:20522432\|PMID:21056402\|PMID:22267198\|PMID:22387016\|PMID:23172776\|PMID:28492532
Rnf227	Rat	Li-Fraumeni syndrome		ISO	RGD:13434539	8554872	ClinVar Annotator: match by term: Li-Fraumeni syndrome	ClinVar	PMID:20522432\|PMID:21056402\|PMID:22267198\|PMID:22387016\|PMID:23172776\|PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf227	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RNF227 mRNA	CTD	PMID:33387578
Rnf227	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:13434539	6480464	Lactic Acid results in decreased expression of RNF227 mRNA	CTD	PMID:30851411
Rnf227	Rat	arsane	multiple interactions	ISO	RGD:13434539	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of RNF227 more ...	CTD	PMID:32525701
Rnf227	Rat	arsenic atom	multiple interactions	ISO	RGD:13434539	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of RNF227 more ...	CTD	PMID:32525701
Rnf227	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:13434539	6480464	Benzo(a)pyrene results in increased methylation of RNF227 promoter	CTD	PMID:27901495
Rnf227	Rat	Benzo[k]fluoranthene	decreases expression	ISO	RGD:1614250	6480464	benzo(k)fluoranthene results in decreased expression of RNF227 mRNA	CTD	PMID:26377693
Rnf227	Rat	bisphenol A	decreases expression	ISO	RGD:13434539	6480464	bisphenol A results in decreased expression of RNF227 mRNA	CTD	PMID:31715268
Rnf227	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RNF227 mRNA	CTD	PMID:30816183\|PMID:34947998
Rnf227	Rat	cadmium dichloride	decreases expression	ISO	RGD:13434539	6480464	Cadmium Chloride results in decreased expression of RNF227 mRNA	CTD	PMID:38568856
Rnf227	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of RNF227 mRNA	CTD	PMID:18500788
Rnf227	Rat	Dibutyl phosphate	affects expression	ISO	RGD:13434539	6480464	di-n-butylphosphoric acid affects the expression of RNF227 mRNA	CTD	PMID:37042841
Rnf227	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of RNF227 mRNA	CTD	PMID:29391264
Rnf227	Rat	ethanol	multiple interactions	ISO	RGD:1614250	6480464	Ethanol affects the expression of and affects the splicing of RNF227 mRNA	CTD	PMID:30319688
Rnf227	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of RNF227 mRNA	CTD	PMID:30307764
Rnf227	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of RNF227 mRNA	CTD	PMID:33387578
Rnf227	Rat	Licochalcone B	increases expression	ISO	RGD:13434539	6480464	licochalcone B results in increased expression of RNF227 mRNA	CTD	PMID:33647349
Rnf227	Rat	methylisothiazolinone	increases expression	ISO	RGD:13434539	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of RNF227 mRNA	CTD	PMID:31629900
Rnf227	Rat	niclosamide	increases expression	ISO	RGD:13434539	6480464	Niclosamide results in increased expression of RNF227 mRNA	CTD	PMID:36318118
Rnf227	Rat	oxaliplatin	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of RNF227 mRNA	CTD	PMID:25729387
Rnf227	Rat	ozone	multiple interactions	ISO	RGD:1614250	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Rnf227	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of RNF227 mRNA	CTD	PMID:33387578
Rnf227	Rat	rac-lactic acid	decreases expression	ISO	RGD:13434539	6480464	Lactic Acid results in decreased expression of RNF227 mRNA	CTD	PMID:30851411
Rnf227	Rat	sodium arsenate	increases expression	ISO	RGD:1614250	6480464	sodium arsenate results in increased expression of RNF227 mRNA	CTD	PMID:30953684
Rnf227	Rat	sodium arsenate	multiple interactions	ISO	RGD:13434539	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of RNF227 more ...	CTD	PMID:32525701
Rnf227	Rat	sodium arsenite	increases expression	ISO	RGD:13434539	6480464	sodium arsenite results in increased expression of RNF227 mRNA	CTD	PMID:38568856
Rnf227	Rat	sodium arsenite	affects expression	ISO	RGD:13434539	6480464	sodium arsenite affects the expression of RNF227 mRNA	CTD	PMID:34032870
Rnf227	Rat	sunitinib	increases expression	ISO	RGD:13434539	6480464	Sunitinib results in increased expression of RNF227 mRNA	CTD	PMID:31533062
Rnf227	Rat	temozolomide	increases expression	ISO	RGD:13434539	6480464	Temozolomide results in increased expression of RNF227 mRNA	CTD	PMID:31758290
Rnf227	Rat	thapsigargin	increases expression	ISO	RGD:13434539	6480464	Thapsigargin results in increased expression of RNF227 mRNA	CTD	PMID:29453283
Rnf227	Rat	topotecan	increases expression	EXP		6480464	Topotecan results in increased expression of RNF227 mRNA	CTD	PMID:25729387
Rnf227	Rat	topotecan	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of RNF227 mRNA	CTD	PMID:25729387
Rnf227	Rat	triphenyl phosphate	affects expression	ISO	RGD:13434539	6480464	triphenyl phosphate affects the expression of RNF227 mRNA	CTD	PMID:37042841
Rnf227	Rat	tunicamycin	increases expression	ISO	RGD:13434539	6480464	Tunicamycin results in increased expression of RNF227 mRNA	CTD	PMID:29453283
Rnf227	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of RNF227 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf227	Rat	protein ubiquitination	involved_in	IBA	MGI:1923322\|PANTHER:PTN001866205\|UniProtKB:Q96D59\|UniProtKB:Q9H0X6\|UniProtKB:Q9NXI6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf227	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rnf227	Rat	ubiquitin protein ligase activity	enables	IBA	MGI:1923322\|PANTHER:PTN001866205\|UniProtKB:Q96D59\|UniProtKB:Q9NXI6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf227	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Rnf227
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,559,862 - 54,561,823 (+)	NCBI		GRCr8
mRatBN7.2	10	54,061,054 - 54,063,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,059,947 - 54,063,010 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,722,733 - 58,723,405 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,211,347 - 58,212,019 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,719,493 - 53,720,165 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,940,533 - 55,941,205 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,940,533 - 55,941,205 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,681,368 - 55,684,924 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,133,424 - 56,134,096 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	53,217,612 - 53,218,284 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

RNF227
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,913,324 - 7,916,318 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,913,339 - 7,916,289 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,816,642 - 7,819,636 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,757,365 - 7,760,499 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	7,844,148 - 7,846,772 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,711,229 - 7,713,853 (-)	NCBI		HuRef
CHM1_1	17	7,825,419 - 7,828,044 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,818,732 - 7,821,726 (-)	NCBI		T2T-CHM13v2.0

Rnf227
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,231,282 - 69,233,467 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,231,287 - 69,233,467 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,340,796 - 69,342,641 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,340,461 - 69,342,641 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,154,271 - 69,156,149 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,157,012 - 69,158,836 (+)	NCBI		MGSCv36	mm8
Celera	11	76,294,623 - 76,296,499 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.52	NCBI

RNF227
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	15,511,339 - 15,514,943 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	17,476,971 - 17,485,904 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,948,370 - 7,951,882 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,936,179 - 7,937,736 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,936,179 - 7,937,723 (-)	Ensembl	panpan1.1		panPan2

RNF227
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	5	32,905,781 - 32,908,292 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,871,607 - 32,874,118 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,871,365 - 32,874,027 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,839,318 - 32,841,829 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,795,353 - 32,797,862 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,974,479 - 32,976,990 (-)	NCBI		UU_Cfam_GSD_1.0

Rnf227
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,682,460 - 47,683,948 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	1,156,137 - 1,158,022 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	1,155,936 - 1,158,022 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RNF227
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	53,163,866 - 53,166,440 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	53,163,996 - 53,166,418 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	55,524,899 - 55,532,596 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RNF227
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	7,296,538 - 7,304,941 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666059	14,103,421 - 14,111,224 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Rnf227
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	169
Count of miRNA genes:	112
Interacting mature miRNAs:	140
Transcripts:	ENSRNOT00000012061
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	6	46	113	82	81	50	25	50	6	200	92	93	44	60	31


RefSeq Transcripts	NM_001126292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF532351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF532352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF532353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF532354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF532355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012061 ⟹ ENSRNOP00000012061

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,059,947 - 54,063,010 (+)	Ensembl
Rnor_6.0 Ensembl	10	55,940,533 - 55,941,205 (+)	Ensembl

RefSeq Acc Id:

NM_001126292 ⟹ NP_001119764

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,559,862 - 54,561,823 (+)	NCBI
mRatBN7.2	10	54,061,054 - 54,063,015 (+)	NCBI
Rnor_6.0	10	55,940,533 - 55,941,205 (+)	NCBI
Rnor_5.0	10	55,681,368 - 55,684,924 (+)	NCBI
RGSC_v3.4	10	56,133,424 - 56,134,096 (+)	RGD
Celera	10	53,217,612 - 53,218,284 (+)	RGD

Sequence:

show sequence

ATGCAGCTCCTGATGAGAGTGCCCTCTCTTCCCGAGCTGGGTGAGCTGGACTGCAACATCTGCTTCCGACCCTACAACCTCGGGGCCCGCGCTCCCCGCCGCCTGCCTGGCACGGCGCGCGCCCGCTG
CGGCCACACGTTGTGCACCGCTTGCCTGCGCGAGCTGGCAGCGCGGGGAGACGGCAGCCGCACGGCCGCGCGTGTGGTGCGCCTGCGCCGTGTTGTCACGTGCCCGTTCTGCCGCGCGCCTTCCCCGC
TCCCGCGCGGCGGCATCACGGAGATCGCGCTAGATCCTGACTTGTGGTCACGGCTGGAGGAAGAAGCCCAGGCTGAGTGTGAAGGAGACCCGATGGGGAGCCCGGCCAAAGAAAGCGGAGAGGATGGA
GAGGACGACGACGGGGAACAGGAGAGCGAGATGGGGGCGGGACCTTCAAGTGCCGGTTGGCGCGCGCTTCGCCGAATTTTGGACAGGGTCCTGGCGCCCGCGCGCCGCTTGCGGCGTCCGTTGCCTAG
CAATGTGCTCTACTGTCCAGAGGTCAAGGACATTGCCCACATGACGCGTTGTACGCTGTGA

hide sequence


Protein RefSeqs	NP_001119764	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABU49278	(Get FASTA)	NCBI Sequence Viewer
	ABU49279	(Get FASTA)	NCBI Sequence Viewer
	ABU49280	(Get FASTA)	NCBI Sequence Viewer
	ABU49281	(Get FASTA)	NCBI Sequence Viewer
	ABU49282	(Get FASTA)	NCBI Sequence Viewer
	EDM04857	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012061
	ENSRNOP00000012061.3

RefSeq Acc Id:	NP_001119764 ⟸ NM_001126292
- UniProtKB:	B2BKZ7 (UniProtKB/TrEMBL), B2BKZ9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQLLMRVPSLPELGELDCNICFRPYNLGARAPRRLPGTARARCGHTLCTACLRELAARGDGSRTAARVVRLRRVVTCPFCRAPSPLPRGGITEIALDPDLWSRLEEEAQAECEGDPMGSPAKESGEDG EDDDGEQESEMGAGPSSAGWRALRRILDRVLAPARRLRRPLPSNVLYCPEVKDIAHMTRCTL hide sequence

Ensembl Acc Id:

ENSRNOP00000012061 ⟸ ENSRNOT00000012061

Protein Domains

RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2BKZ7-F1-model_v2	AlphaFold	B2BKZ7	1-190	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24561	BioCyc
Ensembl Genes	ENSRNOG00000021540	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012061	ENTREZGENE
	ENSRNOT00000012061.6	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
InterPro	DUF4632	UniProtKB/TrEMBL
	RING_finger_E3_ubiq-ligases	UniProtKB/TrEMBL
	Znf-RING_euk	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:497935	UniProtKB/TrEMBL
NCBI Gene	497935	ENTREZGENE
PANTHER	RING FINGER PROTEIN 227	UniProtKB/TrEMBL
	UNCHARACTERIZED	UniProtKB/TrEMBL
Pfam	DUF4632	UniProtKB/TrEMBL
	zf-RING_UBOX	UniProtKB/TrEMBL
PhenoGen	Rnf227	PhenoGen
PROSITE	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021540	RatGTEx
SMART	RING	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	B2BKZ7	ENTREZGENE, UniProtKB/TrEMBL
	B2BKZ9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Rnf227	ring finger protein 227	RGD1563441	similar to RIKEN cDNA A030009H04	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1563441	similar to RIKEN cDNA A030009H04	RGD1563441_predicted	similar to RIKEN cDNA A030009H04 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563441_predicted	similar to RIKEN cDNA A030009H04 (predicted)	LOC497935	similar to RIKEN cDNA A030009H04	Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar