Symbol:
Tob2
Name:
transducer of ERBB2, 2
RGD ID:
1359722
Description:
Predicted to enable nuclear vitamin D receptor binding activity. Predicted to act upstream of or within negative regulation of osteoclast differentiation; positive regulation of ossification; and regulation of gene expression. Predicted to be located in cytosol. Orthologous to human TOB2 (transducer of ERBB2, 2); PARTICIPATES IN RNA degradation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC105824
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TOB2 (transducer of ERBB2, 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Tob2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tob2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TOB2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TOB2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tob2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TOB2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TOB2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tob2 (transducer of ERBB2, 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TOB2 (transducer of ERBB2, 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tob2 (transducer of ERBB2, 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tob
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fog-3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tob2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,242,843 - 115,251,563 (-) NCBI GRCr8 mRatBN7.2 7 113,362,703 - 113,371,423 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,361,148 - 113,372,688 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,125,170 - 115,133,852 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,348,666 - 117,357,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,318,106 - 117,326,788 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,079,520 - 123,088,240 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,079,537 - 123,088,279 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,054,915 - 123,063,635 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,200,815 - 120,209,535 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,235,060 - 120,243,765 (-) NCBI Celera 7 109,681,380 - 109,690,101 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tob2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tob2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOB2 mRNA CTD PMID:36331819 Tob2 Rat 17beta-estradiol multiple interactions ISO TOB2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of TOB2 mRNA CTD PMID:21453500 Tob2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TOB2 mRNA CTD PMID:32145629 Tob2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Tob2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Tob2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TOB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TOB2 mRNA CTD PMID:20106945 Tob2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TOB2 mRNA CTD PMID:32109520 Tob2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tob2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TOB2 mRNA CTD PMID:20159946 and PMID:26377647 Tob2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TOB2 mRNA CTD PMID:21215274 Tob2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TOB2 mRNA CTD PMID:22298810 Tob2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TOB2 mRNA CTD PMID:21346803 Tob2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TOB2 mRNA CTD PMID:21346803 Tob2 Rat 2-hydroxypropanoic acid increases expression ISO TOB2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of TOB2 mRNA CTD PMID:30851411 Tob2 Rat 2-palmitoylglycerol increases expression ISO TOB2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TOB2 mRNA CTD PMID:37199045 Tob2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TOB2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TOB2 mRNA CTD PMID:28628672 Tob2 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TOB2 mRNA CTD PMID:30723492 Tob2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Tob2 (Mus musculus) 6480464 bisphenol S results in decreased expression of TOB2 mRNA CTD PMID:33297965 Tob2 Rat 4,4'-sulfonyldiphenol affects expression ISO Tob2 (Mus musculus) 6480464 bisphenol S affects the expression of TOB2 mRNA CTD PMID:39298647 Tob2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TOB2 mRNA CTD PMID:24780913 Tob2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of TOB2 mRNA CTD PMID:28959563 Tob2 Rat acrylamide increases expression ISO TOB2 (Homo sapiens) 6480464 Acrylamide results in increased expression of TOB2 mRNA CTD PMID:32763439 Tob2 Rat aristolochic acid A increases expression ISO TOB2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TOB2 mRNA CTD PMID:33212167 Tob2 Rat benzo[a]pyrene increases expression ISO TOB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TOB2 mRNA CTD PMID:20106945 Tob2 Rat benzo[a]pyrene increases expression ISO Tob2 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in increased expression of TOB2 mRNA and Benzo(a)pyrene results in increased expression of TOB2 mRNA CTD PMID:21569818 more ... Tob2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TOB2 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Tob2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Tob2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TOB2 mRNA CTD PMID:19850644 Tob2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA and PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of TOB2 mRNA] CTD PMID:19850644 and PMID:39150890 Tob2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TOB2 mRNA CTD PMID:25181051 and PMID:32145629 Tob2 Rat bisphenol F multiple interactions ISO TOB2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TOB2 mRNA CTD PMID:28628672 Tob2 Rat Butylbenzyl phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA CTD PMID:39150890 Tob2 Rat calciol increases expression ISO Tob2 (Mus musculus) 6480464 Cholecalciferol results in increased expression of TOB2 mRNA CTD PMID:17170073 Tob2 Rat carbon nanotube decreases expression ISO Tob2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tob2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of TOB2 mRNA CTD PMID:18668222 Tob2 Rat chlorpyrifos increases expression ISO Tob2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TOB2 mRNA CTD PMID:37019170 Tob2 Rat ciguatoxin CTX1B affects expression ISO Tob2 (Mus musculus) 6480464 Ciguatoxins affects the expression of TOB2 mRNA CTD PMID:18353800 Tob2 Rat clobetasol increases expression ISO Tob2 (Mus musculus) 6480464 Clobetasol results in increased expression of TOB2 mRNA CTD PMID:27462272 Tob2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of TOB2 mRNA CTD PMID:20187946 Tob2 Rat coumestrol decreases expression ISO TOB2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of TOB2 mRNA CTD PMID:19167446 Tob2 Rat cyclosporin A decreases expression ISO TOB2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TOB2 mRNA CTD PMID:20106945 Tob2 Rat dexamethasone increases expression ISO TOB2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of TOB2 mRNA CTD PMID:25047013 Tob2 Rat dexamethasone multiple interactions ISO TOB2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TOB2 mRNA CTD PMID:28628672 Tob2 Rat Dibutyl phosphate affects expression ISO TOB2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TOB2 mRNA CTD PMID:37042841 Tob2 Rat dibutyl phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA CTD PMID:39150890 Tob2 Rat dicrotophos increases expression ISO TOB2 (Homo sapiens) 6480464 dicrotophos results in increased expression of TOB2 mRNA CTD PMID:28302478 Tob2 Rat diethyl phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA CTD PMID:39150890 Tob2 Rat diisobutyl phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA CTD PMID:39150890 Tob2 Rat diisononyl phthalate multiple interactions ISO Tob2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TOB2 mRNA CTD PMID:39150890 Tob2 Rat doxorubicin decreases expression ISO TOB2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TOB2 mRNA CTD PMID:29803840 Tob2 Rat elemental selenium multiple interactions ISO TOB2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TOB2 mRNA CTD PMID:19244175 Tob2 Rat epoxiconazole decreases expression ISO Tob2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TOB2 mRNA CTD PMID:35436446 Tob2 Rat fenthion increases expression ISO Tob2 (Mus musculus) 6480464 Fenthion results in increased expression of TOB2 mRNA CTD PMID:34813904 Tob2 Rat FR900359 affects phosphorylation ISO TOB2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TOB2 protein CTD PMID:37730182 Tob2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of TOB2 mRNA CTD PMID:25539665 Tob2 Rat geldanamycin increases expression ISO TOB2 (Homo sapiens) 6480464 geldanamycin results in increased expression of TOB2 mRNA CTD PMID:26705709 Tob2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TOB2 mRNA CTD PMID:33387578 Tob2 Rat hydrogen cyanide increases expression ISO Tob2 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of TOB2 mRNA CTD PMID:33914522 Tob2 Rat indometacin multiple interactions ISO TOB2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TOB2 mRNA CTD PMID:28628672 Tob2 Rat inulin multiple interactions ISO Tob2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TOB2 mRNA CTD PMID:36331819 Tob2 Rat irinotecan increases expression ISO TOB2 (Homo sapiens) 6480464 Irinotecan metabolite results in increased expression of TOB2 mRNA and Irinotecan results in increased expression of TOB2 mRNA CTD PMID:15956246 Tob2 Rat iron dichloride decreases expression ISO TOB2 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of TOB2 mRNA CTD PMID:35984750 Tob2 Rat isotretinoin increases expression ISO TOB2 (Homo sapiens) 6480464 Isotretinoin results in increased expression of TOB2 mRNA CTD PMID:20436886 Tob2 Rat leflunomide decreases expression ISO TOB2 (Homo sapiens) 6480464 leflunomide results in decreased expression of TOB2 mRNA CTD PMID:28988120 Tob2 Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of TOB2 mRNA CTD PMID:24136188 Tob2 Rat methamphetamine decreases expression ISO Tob2 (Mus musculus) 6480464 Methamphetamine results in decreased expression of TOB2 mRNA CTD PMID:36914120 Tob2 Rat methylmercury chloride increases expression ISO TOB2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TOB2 mRNA CTD PMID:28001369 Tob2 Rat paracetamol affects expression ISO Tob2 (Mus musculus) 6480464 Acetaminophen affects the expression of TOB2 mRNA CTD PMID:17562736 Tob2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TOB2 mRNA CTD PMID:33387578 Tob2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tob2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOB2 mRNA more ... CTD PMID:36331819 Tob2 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of TOB2 mRNA CTD PMID:31324951 Tob2 Rat phenobarbital decreases expression ISO Tob2 (Mus musculus) 6480464 Phenobarbital results in decreased expression of TOB2 mRNA CTD PMID:19363144 and PMID:23091169 Tob2 Rat pirinixic acid decreases expression ISO Tob2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of TOB2 mRNA CTD PMID:23811191 Tob2 Rat potassium cyanide increases expression ISO Tob2 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of TOB2 mRNA CTD PMID:33914522 Tob2 Rat progesterone multiple interactions ISO TOB2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of TOB2 mRNA CTD PMID:21453500 Tob2 Rat rac-lactic acid increases expression ISO TOB2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of TOB2 mRNA CTD PMID:30851411 Tob2 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of TOB2 mRNA CTD PMID:19228061 Tob2 Rat selenium atom multiple interactions ISO TOB2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TOB2 mRNA CTD PMID:19244175 Tob2 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TOB2 mRNA CTD PMID:21297353 Tob2 Rat sodium arsenite increases expression ISO Tob2 (Mus musculus) 6480464 sodium arsenite results in increased expression of TOB2 mRNA CTD PMID:36209798 Tob2 Rat tetrachloromethane affects expression ISO Tob2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TOB2 mRNA CTD PMID:17484886 Tob2 Rat tetrachloromethane increases expression ISO Tob2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TOB2 mRNA CTD PMID:31919559 Tob2 Rat thimerosal decreases expression ISO TOB2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of TOB2 mRNA CTD PMID:27188386 Tob2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TOB2 mRNA CTD PMID:23411599 Tob2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of TOB2 mRNA CTD PMID:34492290 Tob2 Rat thiram increases expression ISO TOB2 (Homo sapiens) 6480464 Thiram results in increased expression of TOB2 mRNA CTD PMID:38568856 Tob2 Rat titanium dioxide increases expression ISO Tob2 (Mus musculus) 6480464 titanium dioxide results in increased expression of TOB2 mRNA CTD PMID:23557971 Tob2 Rat titanium dioxide decreases methylation ISO Tob2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TOB2 gene and titanium dioxide results in decreased methylation of TOB2 promoter CTD PMID:35295148 Tob2 Rat titanium dioxide increases methylation ISO Tob2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of TOB2 promoter CTD PMID:35295148 Tob2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TOB2 mRNA CTD PMID:33387578 Tob2 Rat triphenyl phosphate affects expression ISO TOB2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TOB2 mRNA CTD PMID:37042841 Tob2 Rat troglitazone decreases expression ISO Tob2 (Mus musculus) 6480464 troglitazone results in decreased expression of TOB2 mRNA CTD PMID:28973697 Tob2 Rat trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of TOB2 mRNA CTD PMID:24136188 Tob2 Rat urethane increases expression ISO TOB2 (Homo sapiens) 6480464 Urethane results in increased expression of TOB2 mRNA CTD PMID:28818685 Tob2 Rat valproic acid decreases expression ISO TOB2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TOB2 mRNA CTD PMID:23179753 more ... Tob2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TOB2 mRNA CTD PMID:23034163 Tob2 Rat vitamin E multiple interactions ISO TOB2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TOB2 mRNA CTD PMID:19244175 Tob2 Rat vitamin E decreases expression ISO TOB2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of TOB2 mRNA CTD PMID:19244175 Tob2 Rat vorinostat decreases expression ISO TOB2 (Homo sapiens) 6480464 vorinostat results in decreased expression of TOB2 mRNA CTD PMID:27188386 Tob2 Rat zinc atom multiple interactions ISO TOB2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TOB2 mRNA CTD PMID:18593933 Tob2 Rat zinc(0) multiple interactions ISO TOB2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TOB2 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) Butylbenzyl phthalate (ISO) calciol (ISO) carbon nanotube (ISO) chlorpyrifos (EXP,ISO) ciguatoxin CTX1B (ISO) clobetasol (ISO) cocaine (EXP) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) doxorubicin (ISO) elemental selenium (ISO) epoxiconazole (ISO) fenthion (ISO) FR900359 (ISO) furan (EXP) geldanamycin (ISO) gentamycin (EXP) hydrogen cyanide (ISO) indometacin (ISO) inulin (ISO) irinotecan (ISO) iron dichloride (ISO) isotretinoin (ISO) leflunomide (ISO) levofloxacin (EXP) methamphetamine (ISO) methylmercury chloride (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenformin (EXP) phenobarbital (ISO) pirinixic acid (ISO) potassium cyanide (ISO) progesterone (ISO) rac-lactic acid (ISO) resveratrol (EXP) selenium atom (ISO) sodium arsenite (EXP,ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) trovafloxacin (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Tob2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,242,843 - 115,251,563 (-) NCBI GRCr8 mRatBN7.2 7 113,362,703 - 113,371,423 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,361,148 - 113,372,688 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,125,170 - 115,133,852 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,348,666 - 117,357,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,318,106 - 117,326,788 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,079,520 - 123,088,240 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,079,537 - 123,088,279 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,054,915 - 123,063,635 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,200,815 - 120,209,535 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,235,060 - 120,243,765 (-) NCBI Celera 7 109,681,380 - 109,690,101 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
TOB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 41,433,494 - 41,446,801 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 41,433,492 - 41,446,801 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 41,829,498 - 41,842,805 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 40,159,438 - 40,172,973 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 40,153,991 - 40,167,527 NCBI Celera 22 25,635,881 - 25,649,416 (-) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 24,795,461 - 24,808,986 (-) NCBI HuRef CHM1_1 22 41,789,383 - 41,802,909 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 41,912,328 - 41,926,961 (-) NCBI T2T-CHM13v2.0
Tob2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 81,732,471 - 81,744,742 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 81,732,473 - 81,742,997 (-) Ensembl GRCm39 Ensembl GRCm38 15 81,848,270 - 81,858,326 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 81,848,272 - 81,858,796 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 81,678,700 - 81,688,756 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 81,676,169 - 81,679,400 (-) NCBI MGSCv36 mm8 Celera 15 83,967,342 - 83,977,403 (-) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.26 NCBI
Tob2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 26,999,955 - 27,010,156 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 26,999,955 - 27,010,091 (-) NCBI ChiLan1.0 ChiLan1.0
TOB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 51,266,010 - 51,282,651 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 53,965,292 - 53,980,583 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 22,329,783 - 22,344,795 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 40,418,845 - 40,432,735 (-) NCBI panpan1.1 PanPan1.1 panPan2
TOB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 23,817,778 - 23,830,330 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 23,826,437 - 23,827,447 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 23,750,252 - 23,762,864 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 24,562,440 - 24,574,603 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 24,563,274 - 24,574,596 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 24,279,209 - 24,291,370 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 24,600,087 - 24,612,303 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 24,774,549 - 24,786,712 (+) NCBI UU_Cfam_GSD_1.0
Tob2
TOB2
TOB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 23,975,676 - 23,985,701 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 23,975,979 - 23,977,013 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 101,432,491 - 101,446,470 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tob2
.
Predicted Target Of
Count of predictions: 125 Count of miRNA genes: 101 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000056077, ENSRNOT00000071998 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
BF399642
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 113,370,649 - 113,370,799 (+) MAPPER mRatBN7.2 Rnor_6.0 7 123,087,467 - 123,087,616 NCBI Rnor6.0 Rnor_5.0 7 123,062,862 - 123,063,011 UniSTS Rnor5.0 RGSC_v3.4 7 120,208,762 - 120,208,911 UniSTS RGSC3.4 Celera 7 109,689,328 - 109,689,477 UniSTS RH 3.4 Map 7 887.2 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071998 ⟹ ENSRNOP00000067132
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,361,148 - 113,372,688 (-) Ensembl Rnor_6.0 Ensembl 7 123,079,537 - 123,088,279 (-) Ensembl
RefSeq Acc Id:
NM_001007146 ⟹ NP_001007147
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,242,843 - 115,251,563 (-) NCBI mRatBN7.2 7 113,362,703 - 113,371,423 (-) NCBI Rnor_6.0 7 123,079,520 - 123,088,240 (-) NCBI Rnor_5.0 7 123,054,915 - 123,063,635 (-) NCBI RGSC_v3.4 7 120,200,815 - 120,209,535 (-) RGD Celera 7 109,681,380 - 109,690,101 (-) RGD
Sequence:
AGCGGAAAGAATCACATGAGCTCGGTCCTCGTCTCTCTCTACCCTCAACGACGTAAAAGGACACCGTGGCCCTCAGCCTCGCGGCGCCCGGGAAGCTGAGAGGGAGAGACCTCCGTCCCGCGGCCTGC
hide sequence
RefSeq Acc Id:
NP_001007147 ⟸ NM_001007146
- UniProtKB:
Q5U4F2 (UniProtKB/TrEMBL), A6HT23 (UniProtKB/TrEMBL), M0RC26 (UniProtKB/TrEMBL)
- Sequence:
MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLRGSGFRCVHIGEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLGDGEVGGAQELDKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000067132 ⟸ ENSRNOT00000071998
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Tob2
transducer of ERBB2, 2
Symbol and Name status set to approved
1299863 APPROVED
2005-07-29
Tob2
transducer of ERBB2, 2
Symbol and Name status set to provisional
70820 PROVISIONAL
