Eef1b2 (eukaryotic translation elongation factor 1 beta 2) - Rat Genome Database

Eef1b2 (eukaryotic translation elongation factor 1 beta 2) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Eef1b2 (eukaryotic translation elongation factor 1 beta 2) Rattus norvegicus

Subscribe to Updates

Symbol:

Eef1b2

Name:

eukaryotic translation elongation factor 1 beta 2

RGD ID:

1311415

Description:

Predicted to enable translation elongation factor activity. Involved in response to ethanol. Predicted to be located in endoplasmic reticulum. Predicted to be part of eukaryotic translation elongation factor 1 complex. Orthologous to human EEF1B2 (eukaryotic translation elongation factor 1 beta 2); PARTICIPATES IN translation elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

Previously known as:

elongation factor 1-beta; LOC363241

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	72,074,091 - 72,076,591 (+)	NCBI		GRCr8
mRatBN7.2	9	64,580,163 - 64,582,737 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	64,579,893 - 64,582,737 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	73,083,686 - 73,086,186 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	78,204,606 - 78,207,106 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	76,511,237 - 76,513,737 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	69,953,440 - 69,956,158 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	69,953,440 - 69,956,160 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	69,762,337 - 69,765,055 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	61,832,222 - 61,834,940 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	61,979,375 - 61,981,932 (+)	NCBI
Celera	9	61,998,041 - 62,000,759 (+)	NCBI		Celera
Cytogenetic Map	9	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	Developmental Disabilities		ISO	RGD:1322866	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:25741868
Eef1b2	Rat	epilepsy		ISO	RGD:1322866	8554872	ClinVar Annotator: match by term: Seizure	ClinVar
Eef1b2	Rat	genetic disease		ISO	RGD:1322866	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Eef1b2	Rat	Neurodevelopmental Disorders		ISO	RGD:1322866	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Eef1b2	Rat	primary pulmonary hypertension		ISO	RGD:1322866	8554872	ClinVar Annotator: match by term: Primary pulmonary hypertension	ClinVar	PMID:28492532\|PMID:31727138

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	Breast Neoplasms		ISO	RGD:1322866	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20562527
Eef1b2	Rat	intellectual disability		ISO	RGD:1322866	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21937992
Eef1b2	Rat	Neoplasm Metastasis		ISO	RGD:1322866	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17085005\|PMID:20562527

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	(+)-catechin	multiple interactions	ISO	RGD:1322866	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of EEF1B2 mRNA	CTD	PMID:24763279
Eef1b2	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1322867	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EEF1B2 mRNA	CTD	PMID:36331819
Eef1b2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1322867	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EEF1B2 mRNA	CTD	PMID:22206623
Eef1b2	Rat	17beta-estradiol	decreases phosphorylation	ISO	RGD:1322866	6480464	Estradiol results in decreased phosphorylation of EEF1B2 protein	CTD	PMID:27026707
Eef1b2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1322867	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of EEF1B2 mRNA	CTD	PMID:30294300
Eef1b2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1322867	6480464	Tetrachlorodibenzodioxin affects the expression of EEF1B2 mRNA	CTD	PMID:21570461
Eef1b2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of EEF1B2 mRNA	CTD	PMID:33387578
Eef1b2	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of EEF1B2 mRNA	CTD	PMID:21346803
Eef1b2	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1322866	6480464	[Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ...	CTD	PMID:38598786
Eef1b2	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of EEF1B2 mRNA	CTD	PMID:21346803
Eef1b2	Rat	2-methylcholine	affects expression	ISO	RGD:1322866	6480464	beta-methylcholine affects the expression of EEF1B2 mRNA	CTD	PMID:21179406
Eef1b2	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1322866	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Eef1b2	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:1322867	6480464	4,4'-diaminodiphenylmethane results in increased expression of EEF1B2 mRNA	CTD	PMID:18648102
Eef1b2	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1322867	6480464	bisphenol S results in increased expression of EEF1B2 mRNA	CTD	PMID:39298647
Eef1b2	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1322866	6480464	bisphenol S results in increased expression of EEF1B2 protein	CTD	PMID:34186270
Eef1b2	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Eef1b2	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of EEF1B2 mRNA	CTD	PMID:31881176
Eef1b2	Rat	acrolein	multiple interactions	ISO	RGD:1322866	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of EEF1B2 mRNA	CTD	PMID:32845096
Eef1b2	Rat	actinomycin D	multiple interactions	ISO	RGD:1322866	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of EEF1B2 protein	CTD	PMID:38460933
Eef1b2	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1322866	6480464	[Tretinoin co-treated with arsenic trioxide] results in decreased expression of EEF1B2 protein	CTD	PMID:15894607
Eef1b2	Rat	aristolochic acid A	increases expression	ISO	RGD:1322866	6480464	aristolochic acid I results in increased expression of EEF1B2 protein	CTD	PMID:33212167
Eef1b2	Rat	arsane	affects methylation	ISO	RGD:1322866	6480464	Arsenic affects the methylation of EEF1B2 gene	CTD	PMID:25304211
Eef1b2	Rat	arsenic atom	affects methylation	ISO	RGD:1322866	6480464	Arsenic affects the methylation of EEF1B2 gene	CTD	PMID:25304211
Eef1b2	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1322866	6480464	arsenite promotes the reaction [G3BP1 protein binds to EEF1B2 mRNA]; arsenite promotes the reaction [G3BP1 more ...	CTD	PMID:32406909
Eef1b2	Rat	arsenous acid	multiple interactions	ISO	RGD:1322866	6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of EEF1B2 protein; Arsenic Trioxide inhibits more ...	CTD	PMID:15894607\|PMID:26598702
Eef1b2	Rat	azoxystrobin	increases expression	ISO	RGD:1322866	6480464	azoxystrobin results in increased expression of EEF1B2 mRNA	CTD	PMID:33512557
Eef1b2	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1322867	6480464	Benzo(a)pyrene results in increased expression of EEF1B2 mRNA	CTD	PMID:22228805
Eef1b2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1322866	6480464	Benzo(a)pyrene results in increased methylation of EEF1B2 promoter	CTD	PMID:27901495
Eef1b2	Rat	beta-lapachone	increases expression	ISO	RGD:1322866	6480464	beta-lapachone results in increased expression of EEF1B2 mRNA	CTD	PMID:38218311
Eef1b2	Rat	bis(2-ethylhexyl) phthalate	decreases methylation	ISO	RGD:1322867	6480464	Diethylhexyl Phthalate results in decreased methylation of EEF1B2 gene	CTD	PMID:38833407
Eef1b2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1322867	6480464	Diethylhexyl Phthalate results in decreased expression of EEF1B2 mRNA	CTD	PMID:33754040
Eef1b2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of EEF1B2 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32145629
Eef1b2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Eef1b2	Rat	bisphenol A	affects expression	ISO	RGD:1322866	6480464	bisphenol A affects the expression of EEF1B2 mRNA	CTD	PMID:30903817
Eef1b2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of EEF1B2 gene	CTD	PMID:28505145
Eef1b2	Rat	bisphenol AF	increases expression	ISO	RGD:1322866	6480464	bisphenol AF results in increased expression of EEF1B2 protein	CTD	PMID:34186270
Eef1b2	Rat	bisphenol F	multiple interactions	ISO	RGD:1322866	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Eef1b2	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Eef1b2	Rat	cadmium atom	multiple interactions	ISO	RGD:1322866	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EEF1B2 more ...	CTD	PMID:33040242\|PMID:35301059
Eef1b2	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1322866	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EEF1B2 more ...	CTD	PMID:33040242\|PMID:35301059
Eef1b2	Rat	cadmium dichloride	decreases expression	ISO	RGD:1322866	6480464	Cadmium Chloride results in decreased expression of EEF1B2 protein	CTD	PMID:24419708
Eef1b2	Rat	caffeine	affects phosphorylation	ISO	RGD:1322866	6480464	Caffeine affects the phosphorylation of EEF1B2 protein	CTD	PMID:35688186
Eef1b2	Rat	carbon nanotube	affects expression	ISO	RGD:1322867	6480464	Nanotubes, Carbon affects the expression of EEF1B2 protein	CTD	PMID:21135415
Eef1b2	Rat	chlorpyrifos	decreases expression	ISO	RGD:1322867	6480464	Chlorpyrifos results in decreased expression of EEF1B2 mRNA	CTD	PMID:37019170
Eef1b2	Rat	chromium(6+)	affects expression	ISO	RGD:1322867	6480464	chromium hexavalent ion affects the expression of EEF1B2 mRNA	CTD	PMID:28472532
Eef1b2	Rat	copper atom	multiple interactions	ISO	RGD:1322867	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Eef1b2	Rat	copper(0)	multiple interactions	ISO	RGD:1322867	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Eef1b2	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1322866	6480464	Copper Sulfate results in decreased expression of EEF1B2 mRNA	CTD	PMID:19549813
Eef1b2	Rat	CU-O LINKAGE	decreases expression	ISO	RGD:1322867	6480464	cupric oxide analog results in decreased expression of EEF1B2 protein	CTD	PMID:23882024
Eef1b2	Rat	CU-O LINKAGE	increases expression	ISO	RGD:1322866	6480464	cupric oxide results in increased expression of EEF1B2 protein	CTD	PMID:25470785
Eef1b2	Rat	deguelin	increases expression	ISO	RGD:1322866	6480464	deguelin results in increased expression of EEF1B2 mRNA	CTD	PMID:33512557
Eef1b2	Rat	deoxynivalenol	decreases phosphorylation	ISO	RGD:1322867	6480464	deoxynivalenol results in decreased phosphorylation of EEF1B2 protein	CTD	PMID:23352502
Eef1b2	Rat	dexamethasone	multiple interactions	ISO	RGD:1322866	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Eef1b2	Rat	diarsenic trioxide	multiple interactions	ISO	RGD:1322866	6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of EEF1B2 protein; Arsenic Trioxide inhibits more ...	CTD	PMID:15894607\|PMID:26598702
Eef1b2	Rat	dicrotophos	decreases expression	ISO	RGD:1322866	6480464	dicrotophos results in decreased expression of EEF1B2 mRNA	CTD	PMID:28302478
Eef1b2	Rat	doxorubicin	affects expression	ISO	RGD:1322866	6480464	Doxorubicin affects the expression of EEF1B2 protein	CTD	PMID:29385562
Eef1b2	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:1322866	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Eef1b2	Rat	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of EEF1B2 protein	CTD	PMID:19609968
Eef1b2	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of EEF1B2 mRNA	CTD	PMID:24136188
Eef1b2	Rat	folic acid	multiple interactions	ISO	RGD:1322867	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EEF1B2 mRNA	CTD	PMID:22206623
Eef1b2	Rat	FR900359	increases phosphorylation	ISO	RGD:1322866	6480464	FR900359 results in increased phosphorylation of EEF1B2 protein	CTD	PMID:37730182
Eef1b2	Rat	furfural	multiple interactions	ISO	RGD:1322866	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Eef1b2	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of EEF1B2 mRNA	CTD	PMID:22061828
Eef1b2	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of EEF1B2 mRNA	CTD	PMID:24136188
Eef1b2	Rat	hydrogen sulfide	decreases expression	ISO	RGD:1322867	6480464	Hydrogen Sulfide results in decreased expression of EEF1B2 protein	CTD	PMID:29932956
Eef1b2	Rat	indometacin	multiple interactions	ISO	RGD:1322866	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Eef1b2	Rat	inulin	multiple interactions	ISO	RGD:1322867	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of EEF1B2 mRNA	CTD	PMID:36331819
Eef1b2	Rat	ivermectin	decreases expression	ISO	RGD:1322866	6480464	Ivermectin results in decreased expression of EEF1B2 protein	CTD	PMID:32959892
Eef1b2	Rat	lead(II) chloride	increases expression	ISO	RGD:1322866	6480464	lead chloride results in increased expression of EEF1B2 protein	CTD	PMID:24419708
Eef1b2	Rat	methidathion	increases expression	ISO	RGD:1322867	6480464	methidathion results in increased expression of EEF1B2 mRNA	CTD	PMID:34813904
Eef1b2	Rat	miconazole	increases expression	ISO	RGD:1322867	6480464	Miconazole results in increased expression of EEF1B2 mRNA	CTD	PMID:27462272
Eef1b2	Rat	Monobutylphthalate	decreases expression	ISO	RGD:1322867	6480464	monobutyl phthalate results in decreased expression of EEF1B2 protein	CTD	PMID:20553848
Eef1b2	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of EEF1B2 mRNA	CTD	PMID:24136188
Eef1b2	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of EEF1B2 mRNA	CTD	PMID:24136188
Eef1b2	Rat	nitric oxide	increases expression	ISO	RGD:1322867	6480464	Nitric Oxide deficiency results in increased expression of EEF1B2 mRNA	CTD	PMID:15878706
Eef1b2	Rat	Nutlin-3	multiple interactions	ISO	RGD:1322866	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of EEF1B2 protein	CTD	PMID:38460933
Eef1b2	Rat	ozone	increases expression	EXP		6480464	Ozone results in increased expression of EEF1B2 protein	CTD	PMID:33146391
Eef1b2	Rat	ozone	multiple interactions	ISO	RGD:1322866	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of EEF1B2 mRNA	CTD	PMID:32845096
Eef1b2	Rat	paracetamol	affects expression	ISO	RGD:1322867	6480464	Acetaminophen affects the expression of EEF1B2 mRNA	CTD	PMID:17562736
Eef1b2	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of EEF1B2 mRNA	CTD	PMID:32680482
Eef1b2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1322867	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EEF1B2 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Eef1b2	Rat	picoxystrobin	increases expression	ISO	RGD:1322866	6480464	picoxystrobin results in increased expression of EEF1B2 mRNA	CTD	PMID:33512557
Eef1b2	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	RGD:1322867	6480464	Pregnenolone Carbonitrile results in increased expression of EEF1B2 mRNA	CTD	PMID:28903501
Eef1b2	Rat	pyrimidifen	increases expression	ISO	RGD:1322866	6480464	pyrimidifen results in increased expression of EEF1B2 mRNA	CTD	PMID:33512557
Eef1b2	Rat	pyrogallol	increases expression	ISO	RGD:1322867	6480464	Pyrogallol results in increased expression of EEF1B2 mRNA	CTD	PMID:20362636
Eef1b2	Rat	quercetin	decreases expression	ISO	RGD:1322866	6480464	Quercetin results in decreased expression of EEF1B2 protein	CTD	PMID:19207037
Eef1b2	Rat	rotenone	increases expression	ISO	RGD:1322866	6480464	Rotenone results in increased expression of EEF1B2 mRNA	CTD	PMID:33512557
Eef1b2	Rat	S-butyl-DL-homocysteine (S,R)-sulfoximine	increases expression	ISO	RGD:1322867	6480464	Buthionine Sulfoximine results in increased expression of EEF1B2 mRNA	CTD	PMID:15878706
Eef1b2	Rat	SB 431542	multiple interactions	ISO	RGD:1322866	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of EEF1B2 more ...	CTD	PMID:37664457
Eef1b2	Rat	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of EEF1B2 protein	CTD	PMID:29459688
Eef1b2	Rat	sodium arsenite	decreases expression	ISO	RGD:1322866	6480464	sodium arsenite results in decreased expression of EEF1B2 mRNA; sodium arsenite results in decreased expression more ...	CTD	PMID:30528433\|PMID:38568856
Eef1b2	Rat	sodium chloride	multiple interactions	ISO	RGD:1322866	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Eef1b2	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of EEF1B2 mRNA	CTD	PMID:22561333\|PMID:25993096
Eef1b2	Rat	tetrachloromethane	increases expression	ISO	RGD:1322867	6480464	Carbon Tetrachloride results in increased expression of EEF1B2 mRNA	CTD	PMID:27339419\|PMID:31919559
Eef1b2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of EEF1B2 mRNA	CTD	PMID:34492290
Eef1b2	Rat	triphenyl phosphate	affects expression	ISO	RGD:1322866	6480464	triphenyl phosphate affects the expression of EEF1B2 mRNA	CTD	PMID:37042841
Eef1b2	Rat	triptonide	affects expression	ISO	RGD:1322867	6480464	triptonide affects the expression of EEF1B2 mRNA	CTD	PMID:33045310
Eef1b2	Rat	tungsten	increases expression	ISO	RGD:1322867	6480464	Tungsten results in increased expression of EEF1B2 mRNA	CTD	PMID:30912803
Eef1b2	Rat	valproic acid	decreases expression	ISO	RGD:1322866	6480464	Valproic Acid results in decreased expression of EEF1B2 mRNA	CTD	PMID:23179753
Eef1b2	Rat	valproic acid	decreases methylation	ISO	RGD:1322866	6480464	Valproic Acid results in decreased methylation of EEF1B2 gene	CTD	PMID:29154799
Eef1b2	Rat	zearalenone	decreases expression	ISO	RGD:1322867	6480464	Zearalenone results in decreased expression of EEF1B2 protein	CTD	PMID:36252740

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	response to ethanol		IDA		11041874		RGD
Eef1b2	Rat	translation	involved_in	IEA	UniProtKB-KW:KW-0648	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Eef1b2	Rat	translational elongation	involved_in	IEA	InterPro:IPR001326\|InterPro:IPR014038	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Eef1b2	Rat	translational elongation	involved_in	IEA	UniProtKB-KW:KW-0251	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	cytoplasm	located_in	IEA	ARBA:ARBA00026971	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Eef1b2	Rat	cytoplasm	located_in	IEA	UniProtKB:P24534\|ensembl:ENSP00000376056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Eef1b2	Rat	cytoplasm	located_in	ISO	RGD:1322866	1624291	PMID:12426392, PMID:8743958	RGD	PMID:12426392\|PMID:8743958
Eef1b2	Rat	endoplasmic reticulum	located_in	ISO	RGD:1322866	1624291	PMID:8743958	RGD	PMID:8743958
Eef1b2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:P24534\|ensembl:ENSP00000376056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Eef1b2	Rat	eukaryotic translation elongation factor 1 complex	part_of	IEA	InterPro:IPR049720	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Eef1b2	Rat	nucleus	NOT\|located_in	ISO	RGD:1322866	1624291	PMID:12426392	RGD	PMID:12426392

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	protein binding	enables	ISO	RGD:1322866	1624291	UniProtKB:P26641\|UniProtKB:P26641-2\|UniProtKB:P42858\|UniProtKB:Q8WW59 PMID:16169070, PMID:16189514, PMID:25416956, PMID:25959826, PMID:28514442, PMID:32296183, PMID:32814053, PMID:33961781, PMID:35271311	RGD	PMID:16169070\|PMID:16189514\|PMID:25416956\|PMID:25959826\|PMID:28514442\|PMID:32296183\|PMID:32814053\|PMID:33961781\|PMID:35271311
Eef1b2	Rat	protein binding	enables	ISO	RGD:1322867	1624291	PR:E9Q9D5 PMID:23055941	RGD	PMID:23055941
Eef1b2	Rat	translation elongation factor activity	enables	IEA	UniProtKB-KW:KW-0251	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Eef1b2	Rat	translation elongation factor activity	enables	IEA	InterPro:IPR001326\|InterPro:IPR014038\|InterPro:IPR049720	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Eef1b2	Rat	translation elongation pathway		ISO	RGD:1322866	10044026		RGD

#	Reference Title	Reference Citation
1.	The elongation, termination, and recycling phases of translation in eukaryotes.	Dever TE and Green R, Cold Spring Harb Perspect Biol. 2012 Jul 1;4(7):a013706. doi: 10.1101/cshperspect.a013706.
2.	Prenatal alcohol exposure alters phosphorylation and glycosylation of proteins in rat offspring liver.	Fofana B, etal., Proteomics. 2010 Feb;10(3):417-34. doi: 10.1002/pmic.200800969.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:8743958	PMID:12426392	PMID:12477932	PMID:24625528	PMID:25002582	PMID:35352799

Eef1b2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	72,074,091 - 72,076,591 (+)	NCBI		GRCr8
mRatBN7.2	9	64,580,163 - 64,582,737 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	64,579,893 - 64,582,737 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	73,083,686 - 73,086,186 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	78,204,606 - 78,207,106 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	76,511,237 - 76,513,737 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	69,953,440 - 69,956,158 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	69,953,440 - 69,956,160 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	69,762,337 - 69,765,055 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	61,832,222 - 61,834,940 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	61,979,375 - 61,981,932 (+)	NCBI
Celera	9	61,998,041 - 62,000,759 (+)	NCBI		Celera
Cytogenetic Map	9	q32	NCBI

EEF1B2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	206,159,609 - 206,162,928 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	206,159,585 - 206,162,928 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	207,024,333 - 207,027,652 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	206,732,563 - 206,735,898 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	206,849,839 - 206,853,157	NCBI
Celera	2	200,781,747 - 200,785,083 (+)	NCBI		Celera
Cytogenetic Map	2	q33.3	NCBI
HuRef	2	198,872,898 - 198,876,236 (+)	NCBI		HuRef
CHM1_1	2	207,030,874 - 207,034,213 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	206,641,502 - 206,644,822 (+)	NCBI		T2T-CHM13v2.0

Eef1b2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	63,215,990 - 63,219,645 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	63,215,984 - 63,219,645 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	63,176,831 - 63,180,486 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	63,176,825 - 63,180,486 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	63,223,405 - 63,227,060 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	63,099,699 - 63,113,932 (+)	NCBI		MGSCv36	mm8
Celera	1	63,687,221 - 63,690,876 (+)	NCBI		Celera
Cytogenetic Map	1	C2	NCBI
cM Map	1	32.31	NCBI

Eef1b2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955457	8,835,121 - 8,837,816 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955457	8,835,121 - 8,837,816 (-)	NCBI	ChiLan1.0	ChiLan1.0

EEF1B2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	108,773,675 - 108,776,640 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	108,788,618 - 108,791,622 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	93,399,413 - 93,402,779 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	211,528,491 - 211,531,826 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	211,528,497 - 211,531,826 (+)	Ensembl	panpan1.1		panPan2

EEF1B2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	14,713,927 - 14,716,894 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	14,714,017 - 14,716,850 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	15,590,671 - 15,593,638 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	14,649,290 - 14,652,257 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	14,649,380 - 14,652,213 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	14,603,540 - 14,606,497 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	14,575,797 - 14,578,764 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	14,572,093 - 14,575,060 (+)	NCBI		UU_Cfam_GSD_1.0

Eef1b2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	162,904,145 - 162,907,175 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936631	2,539,070 - 2,542,419 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936631	2,539,075 - 2,542,252 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EEF1B2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	109,451,514 - 109,455,525 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	109,451,901 - 109,455,529 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	121,000,537 - 121,004,164 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EEF1B2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	91,927,639 - 91,930,972 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	107,448,123 - 107,451,477 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eef1b2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	9,958,907 - 9,962,108 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	9,958,908 - 9,962,074 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Eef1b2
7 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	74
Count of miRNA genes:	67
Interacting mature miRNAs:	70
Transcripts:	ENSRNOT00000034740
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1598849	Memor17	Memory QTL 17	2.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	49968546	71098346	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
1578659	Tspe1	Trichinella spiralis expulsion QTL 1	4.8		parasite quantity (VT:0010441)	logarithm of the intestinal adult Trichinella spiralis count (CMO:0002024)	9	61381434	65691299	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168738	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034740 ⟹ ENSRNOP00000036882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	64,580,009 - 64,582,733 (+)	Ensembl
Rnor_6.0 Ensembl	9	69,953,440 - 69,956,160 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113520 ⟹ ENSRNOP00000091436

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	64,579,893 - 64,582,737 (+)	Ensembl

RefSeq Acc Id:

NM_001108799 ⟹ NP_001102269

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	72,074,091 - 72,076,591 (+)	NCBI
mRatBN7.2	9	64,580,237 - 64,582,737 (+)	NCBI
Rnor_6.0	9	69,953,440 - 69,956,158 (+)	NCBI
Rnor_5.0	9	69,762,337 - 69,765,055 (+)	NCBI
RGSC_v3.4	9	61,832,222 - 61,834,940 (+)	RGD
Celera	9	61,998,041 - 62,000,759 (+)	RGD

Sequence:

show sequence

CCTTTAGTTTTAGAATCCTTGGAGGTAGGCGTTTTAAAATGCATCTTTTATTAATTTCCTTCCAAACACAAGGAAAAGCCCGCGGACGACCTGTGGGTCGTCTAATTCACAAGACGCAGTTTTACGTG
AAGGAACGAGACTAGTAACGTACTTTGACCTTTAACCTCTAGCCGGTGCAGTGGAGGGAAACGCCTCCGTCTCTATATAAGGACTTTTCCGGCCGGTCCCGGCCCTTTTTCTCCCTCAGCGCTGGCCG
CGGGCTTCTAGCGCTCTTTTCCTCCGCTCCCGGTTACAGTCGACGCCATGGGTTTCGGAGACCTGAAAACCCCCGCCGGCCTCCAGGTGCTCAACGATTACCTGGCGGACAAGAGCTACATTGAGGGG
TACGTGCCATCACAAGCCGATGTGGCAGTATTTGAAGCAATCTCTGGTCCACCACCCGCTGACCTGTGTCATGCTCTGCGTTGGTATAATCATATCAAATCTTACGAAAAAGAAAAGGCCAGCTTGCC
GGGAGTGAAGAAATCTTTGGGCAAGTATGGCCCTGTCAGTGTGGCAGATACCACAGGAAGTGGAGCAGCAGATGCTAAAGACGATGATGACATTGATCTCTTCGGATCTGATGATGAGGAGGAAAGTG
AAGACGCAAAGAGGCTACGAGAAGAACGCCTTGCTCAGTATGAGTCAAAGAAAGCTAAAAAGCCTGCAGTTGTTGCGAAGTCTTCCATCTTGTTAGATGTGAAGCCTTGGGACGATGAGACAGACATG
ACGAAACTTGAGGAGTGTGTCCGAAGCATTCAAGCGGACGGCTTGGTGTGGGGCTCCTCTAAATTGGTTCCAGTGGGATACGGAATTAAAAAGCTTCAAATACAGTGTGTAGTTGAAGATGATAAGGT
TGGAACAGATATGCTGGAAGAGCAGATTACTGCTTTTGAGGACTATGTACAGTCCATGGATGTGGCTGCTTTTAACAAAATCTAAATCATCCTTAAGTCTGTGCACTTAAATAAAAGCTCGAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001102269	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68738	(Get FASTA)	NCBI Sequence Viewer
	EDL98899	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000036882
	ENSRNOP00000036882.4
	ENSRNOP00000091436.1

RefSeq Acc Id:

NP_001102269 ⟸ NM_001108799

- UniProtKB:

B5DEN5 (UniProtKB/TrEMBL), A6IPG1 (UniProtKB/TrEMBL), A0A8I6AEG7 (UniProtKB/TrEMBL), F6SZC1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAISGPPPADLCHALRWYNHIKSYEKEKASLPGVKKSLGKYGPVSVADTTGSGAADAKDDDDIDLFGSDDEEESEDAKRLREERLAQYES
KKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

hide sequence

Ensembl Acc Id:

ENSRNOP00000036882 ⟸ ENSRNOT00000034740

Ensembl Acc Id:

ENSRNOP00000091436 ⟸ ENSRNOT00000113520

Protein Domains

Elongation factor 1 beta central acidic region Translation elongation factor EF1B beta/delta

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DEN5-F1-model_v2	AlphaFold	B5DEN5	1-225	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Eef1b2_1

Description:

eukaryotic translation elongation factor 1 beta 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	69,953,671 - 69,953,731	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-27352	BioCyc
Ensembl Genes	ENSRNOG00000024186	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000034740	ENTREZGENE
	ENSRNOT00000034740.5	UniProtKB/TrEMBL
	ENSRNOT00000113520.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1050.130	UniProtKB/TrEMBL
	3.30.70.60	UniProtKB/TrEMBL
InterPro	eEF-1beta-like_sf	UniProtKB/TrEMBL
	EF-1_beta_acid_region_euk	UniProtKB/TrEMBL
	EF1B_bsu/dsu	UniProtKB/TrEMBL
	Glutathione-S-Trfase_C_sf	UniProtKB/TrEMBL
	Transl_elong_EF1B/ribosomal_S6	UniProtKB/TrEMBL
	Transl_elong_EF1B_B/D_CS	UniProtKB/TrEMBL
	Transl_elong_fac_EF1B_bsu/dsu	UniProtKB/TrEMBL
KEGG Report	rno:363241	UniProtKB/TrEMBL
NCBI Gene	363241	ENTREZGENE
PANTHER	EF-HAND AND COILED-COIL DOMAIN-CONTAINING FAMILY MEMBER	UniProtKB/TrEMBL
	ELONGATION FACTOR 1-BETA	UniProtKB/TrEMBL
Pfam	EF-1_beta_acid	UniProtKB/TrEMBL
	EF1_GNE	UniProtKB/TrEMBL
PhenoGen	Eef1b2	PhenoGen
PROSITE	EF1BD_1	UniProtKB/TrEMBL
	EF1BD_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024186	RatGTEx
SMART	EF-1_beta_acid	UniProtKB/TrEMBL
	EF1_GNE	UniProtKB/TrEMBL
Superfamily-SCOP	GST_C_like	UniProtKB/TrEMBL
	Transl_elong_EF1B_B/D_G_exch	UniProtKB/TrEMBL
UniProt	A0A8I6AEG7	ENTREZGENE, UniProtKB/TrEMBL
	A6IPG1	ENTREZGENE, UniProtKB/TrEMBL
	B5DEN5	ENTREZGENE
	F6SZC1	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B5DEN5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Eef1b2	eukaryotic translation elongation factor 1 beta 2	Eef1b2_predicted	eukaryotic translation elongation factor 1 beta 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Eef1b2_predicted	eukaryotic translation elongation factor 1 beta 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED