Advanced Search (OLGA)

Gene: Snx30 (sorting nexin family member 30) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Snx30

Name:

sorting nexin family member 30

RGD ID:

1311367

Description:

Predicted to enable phosphatidylinositol binding activity. Predicted to be involved in several processes, including endocytic recycling; macroautophagy; and positive regulation of autophagosome assembly. Predicted to be located in early endosome membrane. Predicted to be active in early endosome and phagophore assembly site. Orthologous to human SNX30 (sorting nexin family member 30); INTERACTS WITH 17alpha-ethynylestradiol; acetamide; amphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC298033; RGD1311367; similar to Sorting nexin 7; sorting nexin-30

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNX30 (sorting nexin family member 30)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Snx30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snx30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNX30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNX30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Snx30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNX30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNX30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snx30 (sorting nexin family member 30)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Snx30 (sorting nexin family member 30)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SNX30 (sorting nexin family member 30)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snx30 (sorting nexin family member 30)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SNX4	Alliance	DIOPT (Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	snx30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	79,478,804 - 79,608,118 (+)	NCBI		GRCr8
mRatBN7.2	5	74,683,902 - 74,813,013 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	74,684,015 - 74,792,631 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	76,588,866 - 76,692,768 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	78,410,501 - 78,514,403 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	78,382,679 - 78,486,566 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	77,052,445 - 77,161,964 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	77,052,484 - 77,157,915 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	81,185,823 - 81,292,332 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	77,924,034 - 78,037,119 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	77,929,367 - 78,042,520 (+)	NCBI
Celera	5	73,498,886 - 73,602,194 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snx30	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of SNX30 mRNA	CTD	PMID:29097150
Snx30	Rat	17beta-estradiol	increases expression	ISO	Snx30 (Mus musculus)	6480464	Estradiol results in increased expression of SNX30 mRNA	CTD	PMID:39298647
Snx30	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Snx30 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SNX30 mRNA	CTD	PMID:21889950
Snx30	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Snx30 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SNX30 mRNA	CTD	PMID:21570461 and PMID:26377647
Snx30	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Snx30 (Mus musculus)	6480464	bisphenol S results in decreased expression of SNX30 mRNA	CTD	PMID:39298647
Snx30	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of SNX30 mRNA	CTD	PMID:31881176
Snx30	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of SNX30 mRNA	CTD	PMID:30779732
Snx30	Rat	Aroclor 1254	increases expression	ISO	Snx30 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of SNX30 mRNA	CTD	PMID:25270620
Snx30	Rat	benzo[a]pyrene	decreases expression	ISO	SNX30 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of SNX30 mRNA	CTD	PMID:20106945 and PMID:21632981
Snx30	Rat	benzo[a]pyrene	decreases methylation	ISO	SNX30 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of SNX30 promoter	CTD	PMID:27901495
Snx30	Rat	benzo[a]pyrene	increases expression	ISO	SNX30 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of SNX30 mRNA	CTD	PMID:30453624
Snx30	Rat	benzo[a]pyrene	affects methylation	ISO	SNX30 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SNX30 intron	CTD	PMID:30157460
Snx30	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Snx30 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of SNX30 mRNA	CTD	PMID:34319233
Snx30	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SNX30 mRNA	CTD	PMID:25181051 and PMID:29097150
Snx30	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SNX30 mRNA	CTD	PMID:32145629
Snx30	Rat	bisphenol A	increases expression	ISO	SNX30 (Homo sapiens)	6480464	bisphenol A results in increased expression of SNX30 mRNA	CTD	PMID:29275510
Snx30	Rat	bisphenol F	increases expression	ISO	Snx30 (Mus musculus)	6480464	bisphenol F results in increased expression of SNX30 mRNA	CTD	PMID:38685157
Snx30	Rat	cadmium atom	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SNX30 mRNA	CTD	PMID:35301059
Snx30	Rat	cadmium dichloride	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SNX30 mRNA	CTD	PMID:35301059
Snx30	Rat	caffeine	affects phosphorylation	ISO	SNX30 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of SNX30 protein	CTD	PMID:35688186
Snx30	Rat	calcitriol	increases expression	ISO	SNX30 (Homo sapiens)	6480464	Calcitriol results in increased expression of SNX30 mRNA	CTD	PMID:16002434
Snx30	Rat	chlorpyrifos	increases expression	ISO	Snx30 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of SNX30 mRNA	CTD	PMID:37019170
Snx30	Rat	cyclosporin A	decreases expression	ISO	SNX30 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of SNX30 mRNA	CTD	PMID:27989131
Snx30	Rat	daidzein	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	daidzein 7-O-beta-D-glucoside	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	Dibutyl phosphate	affects expression	ISO	SNX30 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of SNX30 mRNA	CTD	PMID:37042841
Snx30	Rat	genistein	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	genistein 7-O-beta-D-glucoside	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of SNX30 mRNA	CTD	PMID:33387578
Snx30	Rat	glycitein	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	glycitin	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of SNX30 mRNA	CTD	PMID:27424125
Snx30	Rat	glyphosate	increases expression	ISO	Snx30 (Mus musculus)	6480464	Glyphosate results in increased expression of SNX30 mRNA	CTD	PMID:35897073
Snx30	Rat	lipopolysaccharide	decreases expression	ISO	SNX30 (Homo sapiens)	6480464	Lipopolysaccharides results in decreased expression of SNX30 mRNA	CTD	PMID:35811015
Snx30	Rat	lipopolysaccharide	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Snx30	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of SNX30 gene	CTD	PMID:35440735
Snx30	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SNX30 mRNA	CTD	PMID:33387578
Snx30	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Snx30 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of SNX30 mRNA	CTD	PMID:37995155
Snx30	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	Snx30 (Mus musculus)	6480464	Pregnenolone Carbonitrile results in decreased expression of SNX30 mRNA	CTD	PMID:28903501
Snx30	Rat	resveratrol	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of SNX30 mRNA	CTD	PMID:23557933
Snx30	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	SNX30 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Snx30	Rat	sodium arsenate	decreases expression	ISO	Snx30 (Mus musculus)	6480464	sodium arsenate results in decreased expression of SNX30 mRNA	CTD	PMID:21795629
Snx30	Rat	sunitinib	increases expression	ISO	SNX30 (Homo sapiens)	6480464	Sunitinib results in increased expression of SNX30 mRNA	CTD	PMID:31533062
Snx30	Rat	tetrachloromethane	affects expression	ISO	Snx30 (Mus musculus)	6480464	Carbon Tetrachloride affects the expression of SNX30 mRNA	CTD	PMID:17484886
Snx30	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of SNX30 mRNA	CTD	PMID:31150632
Snx30	Rat	titanium dioxide	decreases methylation	ISO	Snx30 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SNX30 gene	CTD	PMID:35295148
Snx30	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of SNX30 gene	CTD	PMID:27618143
Snx30	Rat	urethane	increases expression	ISO	SNX30 (Homo sapiens)	6480464	Urethane results in increased expression of SNX30 mRNA	CTD	PMID:28818685
Snx30	Rat	valproic acid	increases expression	ISO	SNX30 (Homo sapiens)	6480464	Valproic Acid results in increased expression of SNX30 mRNA	CTD	PMID:28001369

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snx30	Rat	endocytic recycling	involved_in	IBA	PANTHER:PTN002915053 and SGD:S000003573	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snx30	Rat	mitophagy	involved_in	IBA	PANTHER:PTN002915053 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snx30	Rat	piecemeal microautophagy of the nucleus	involved_in	IBA	PANTHER:PTN002915053 and SGD:S000003573	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snx30	Rat	positive regulation of autophagosome assembly	involved_in	ISO	SNX30 (Homo sapiens)	1624291	PMID:32513819	RGD	PMID:32513819
Snx30	Rat	positive regulation of autophagosome assembly	involved_in	IEA	UniProtKB:Q5VWJ9 and ensembl:ENSP00000363349	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snx30	Rat	protein transport	involved_in	ISO	SNX30 (Homo sapiens)	1624291	PMID:32513819	RGD	PMID:32513819
Snx30	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snx30	Rat	protein transport	involved_in	IEA	UniProtKB:Q5VWJ9 and ensembl:ENSP00000363349	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snx30	Rat	protein transport	involved_in	IBA	PANTHER:PTN002915053 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snx30	Rat	reticulophagy	involved_in	IBA	PANTHER:PTN002915053 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snx30	Rat	cytoplasm	located_in	IEA	ARBA:ARBA00026971	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Snx30	Rat	early endosome	is_active_in	ISO	SNX30 (Homo sapiens)	1624291	PMID:32513819	RGD	PMID:32513819
Snx30	Rat	early endosome	is_active_in	IEA	UniProtKB:Q5VWJ9 and ensembl:ENSP00000363349	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snx30	Rat	early endosome	is_active_in	IBA	PANTHER:PTN002915053 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snx30	Rat	early endosome membrane	located_in	IEA	UniProtKB-SubCell:SL-0093	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Snx30	Rat	phagophore assembly site	is_active_in	IBA	PANTHER:PTN002915053 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snx30	Rat	phosphatidylinositol binding	enables	IEA	InterPro:IPR001683 and InterPro:IPR036871	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Snx30	Rat	protein binding	enables	ISO	SNX30 (Homo sapiens)	1624291	UniProtKB:O95219 more ...	RGD	PMID:23085988 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Snx30
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	79,478,804 - 79,608,118 (+)	NCBI		GRCr8
mRatBN7.2	5	74,683,902 - 74,813,013 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	74,684,015 - 74,792,631 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	76,588,866 - 76,692,768 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	78,410,501 - 78,514,403 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	78,382,679 - 78,486,566 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	77,052,445 - 77,161,964 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	77,052,484 - 77,157,915 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	81,185,823 - 81,292,332 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	77,924,034 - 78,037,119 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	77,929,367 - 78,042,520 (+)	NCBI
Celera	5	73,498,886 - 73,602,194 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

SNX30
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	112,749,723 - 112,885,769 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	112,750,760 - 112,881,671 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	115,513,040 - 115,637,267 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	114,552,955 - 114,677,088 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	86,330,021 - 86,454,125 (-)	NCBI		Celera
Cytogenetic Map	9	q32	NCBI
HuRef	9	85,110,784 - 85,235,103 (+)	NCBI		HuRef
CHM1_1	9	115,660,589 - 115,784,556 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	124,920,960 - 125,057,645 (+)	NCBI		T2T-CHM13v2.0

Snx30
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	59,805,137 - 59,904,740 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	59,805,840 - 59,904,737 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	59,805,131 - 59,904,740 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	59,805,840 - 59,904,737 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	59,818,522 - 59,917,612 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	59,899,704 - 59,998,794 (+)	NCBI		MGSCv36	mm8
Celera	4	59,722,562 - 59,821,429 (+)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	32.81	NCBI

Snx30
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	14,567,317 - 14,619,637 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	14,567,317 - 14,645,442 (-)	NCBI	ChiLan1.0	ChiLan1.0

SNX30
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	26,565,460 - 26,684,584 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	26,567,819 - 26,686,947 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	83,878,128 - 83,997,124 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	112,031,879 - 112,150,074 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	112,031,860 - 112,143,933 (+)	Ensembl	panpan1.1		panPan2

SNX30
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	67,233,469 - 67,294,159 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	67,233,256 - 67,289,224 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	65,593,004 - 65,700,845 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	68,312,076 - 68,420,280 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	68,310,972 - 68,451,983 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	66,828,471 - 66,936,337 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	66,851,734 - 66,959,739 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	67,596,127 - 67,704,210 (+)	NCBI		UU_Cfam_GSD_1.0

Snx30
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	182,473,720 - 182,582,022 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936559	690,397 - 792,835 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936559	684,536 - 792,829 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNX30
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	253,428,508 - 253,550,375 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	253,428,461 - 253,555,463 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	284,234,538 - 284,364,775 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SNX30
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	26,650,088 - 26,774,395 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	26,656,221 - 26,774,009 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	16,017,007 - 16,141,389 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snx30
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	22,144,510 - 22,261,296 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	22,138,646 - 22,261,392 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Snx30
877 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	486
Count of miRNA genes:	241
Interacting mature miRNAs:	290
Transcripts:	ENSRNOT00000059419
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059419 ⟹ ENSRNOP00000056176

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	74,684,020 - 74,792,631 (+)	Ensembl
Rnor_6.0 Ensembl	5	77,052,484 - 77,157,915 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087254 ⟹ ENSRNOP00000069076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	74,684,015 - 74,791,090 (+)	Ensembl
Rnor_6.0 Ensembl	5	77,052,508 - 77,156,572 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108184 ⟹ ENSRNOP00000079165

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	74,684,432 - 74,792,631 (+)	Ensembl

RefSeq Acc Id:

NM_001106651 ⟹ NP_001100121

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	79,478,942 - 79,587,555 (+)	NCBI
mRatBN7.2	5	74,684,020 - 74,792,631 (+)	NCBI
Rnor_6.0	5	77,052,484 - 77,157,915 (+)	NCBI
Rnor_5.0	5	81,185,823 - 81,292,332 (+)	NCBI
RGSC_v3.4	5	77,924,034 - 78,037,119 (+)	RGD
Celera	5	73,498,886 - 73,602,194 (+)	RGD

Sequence:

show sequence

GTGGGCGGCGTGGCGCTGCTACCAGGGCGCAGGGCCGTAGGTGCTGGGGATCGCGGCGACTTAGCCCACGGATCTGCGGTGTGTTGCTCAGGAAAGCTCATCCTCCCGGGCAGGAGAAGCATCGGGCG
AAGGCTGCCCCCACCGACTAGTGCAGGGCCTCAGGCCGAGTAGGGCCGAGAGCTACGGGAGTAAGCGGCGGCGGGTCCCGAGCGCAGCGCGCCATGGCGGGCGGGCCCCCCAAGGCCCTGCCGTCCAC
GGGGCCCCAGTCCTTGCGCGACATGCCCCACCCGCTAGCGGGCTCCAGCAGCGAGGAGGCCGTGGGAGGCGACAGCACGCCCAGCCCGGACCTACTGATGGCCCGCAGCTTCGGTGACAAGGATCTCA
TCTTGCCCAATGGTGGTACTCCAGCAGGCACTTCAAGCCCAGCTTCTTCATCTTCGCTTTTGAACAGACTTCAGCTGGATGATGACATTGATGGTGAAACCAGAGATCTCTTTGTCACAGTTGATGAT
CCCAAGAAGCATGTCTGCACAATGGAGACCTACATCACGTACAGGATCACCACCAAAAGCACACGGGTGGAGTTTGACTTGCCAGAGTATTCCGTTCGTCGACGATACCAGGATTTCGACTGGTTGAG
GAACAAACTGGAAGAGTCGCAGCCCACTCATCTCATTCCCCCACTTCCTGAGAAGTTTGTGGTGAAGGGTGTCGTGGATCGTTTTTCAGAAGAGTTTGTGGAGACCAGAAGAAAAGCGTTGGACAAAT
TCCTAAAAAGGATTACAGATCACCCAGTGCTCTCTTTCAATGAACACTTCAATGTGTTCCTCACTGCTAAGGACCTGAATGCCTACAAGAAGCAGGGGATAGCACTGCTGACCAGAGTGGGGGAGTCG
GTCAAGCATGTCACTGGAGGCTACAAGCTGCGGAGTCGGCCTCTGGAGTTTGCAGCCATCGGTGACTACTTAGACACTTTTGCACTCAAACTGGGAACCATTGATCGGATAGCCCAGCGGATCATCAA
AGAAGAAATAGAGTACCTCGTGGAGCTGAGGGAGTATGGGCCTGTGTATTCCACGTGGAGCGCCTTGGAAGGTGAGCTGGCGGAGCCCCTGGAGGGTGTGTCAGCCTGCATTGGGAACTGCTCCACAG
CCTTGGAAGAGCTGACGGATGACATAACAGAAGAGTTTCTGCCTGTGCTCAGGGAATACATTCTATACTCTGACTCCATGAAGGGTGTGTTGAAGAAGAGGGACCAAGTTCATGCAGAGTATGAAGCC
AAACTGGAAGCTGTGGCTCTGAGGAAAGAAGATCGCCCCAAGGTGCCAGCAGATGTGGAGAAGTGCCAGGACAGGATGGAGTGCTTCAACGCAGACCTGAAGGCTGATATGGAGAGGTGGCAGGGCAA
CAAGCGAAATGACTTCCGGCAGCTGCTCGTGGGCTTGGCTGACAAGAATATCCAGTATTATGAGAAGTGCCTCATGGCGTGGGAGTCGATTATTCCACTACTGCAAGAGAAACAAGAGGCCAAGTAGC
TTTGGTTTTGGAGAAAAGACTCTTCTGCCTCCACAGGGCATGGTACCCTGAACCTGAATGTCCCTGCAGTGCCGGAGAGGTCGCCGTGGGAAAACAGCACAACACCACCTCTTGAGTGTGTACTTTCT
CCCCACCCACCCCCAGTCGTTTTCAGTTAGTATTTATTCCTTGGAGTCTGTGAGGCTGTAATCATCTCTCAGCAGAAGCATACCTCCATATTGTGAAGGAACCTCTTAATGGAACACTATGAAGACTT
TTGAAACTGAGGGGCAGGATAACCCCCACTTGACCTGTGACATCACTTTGGGAGCATCCCAGTTGCCATTGTGGGACAGAACCCCAGTCCTGCATTTCGGGGACATGGGGAGGCATGAAGAGGGCAGC
TGCGGCTTGCTGTGGAGACATCTTAGCTCTGCACTTTACCCGTGAGGGCATTAATGTGACCCAGCATGGAAGGAGGTGTAGGTACCTTCTCTCTCGGAAAGTCCTTAATTTACAGTGGCCTGTGGCTG
TGGCTGCGGCTCTGGCTGTGGCTGTGGCTGTGGCAGGTCTACTGCCTGCTCGTGATGAGTGGCATCTATGTACTTGTTTCTGGTTCACACGGGGCCACCTAAATCTGTGTCTGGGAGCATCGATGCTT
GAGTGAGCAAGCCAGCGTCCTTGTCCTTAATGGATGCCTCAGGATCTTGTTTCTGACCCCAGAATGCAGCAGAGGAGAAGCTTTTTGGTGTGAACTGGATAAAAAAAGGTGCATTTTTCTCTGTGAAG
GTCTTGGTGTGTGTGTTTTCCGTGTTAACTGTCATCATGGTTGGGATTAGACCTGTTTGCAAACAGCTGCTGTCAATGACACTCCTGTGTGCCAAGCCCCAGCTCTGATGTCTGCTTTGTGCAATTTG
CCTTTACTTCACCAAAAATGTCTCATTTAATCTGTCTGCCATGCCCGCTGACTGTCTGGGCAGCCTTGCGGTGAGGGCTGTGTGCTGCATTATTGCTGTCACTATGTGTAAACTCAGTGTGACTGCTC
TACATGAGTGTTTTAACCCTCACGATTCTGTGGCCAGAAAGAAAACAGCATCTGCAGGTCCCTCAGAGACGAGAAGAGTGAGCGACATCGTGCTCTTTGCTTCTGGCTATGTAGAAATCCTCATTTGT
AGCTAAAATCTGGGGGCTGCAGCTGTGCTTAAAGTCTTCATTTGAAGCTTTCCAAATTGCCATAAGCCAACAATCAGAAAGAATCTCTCTCTTCCATACCGTTGCTCTTGCTAAAAAGAAGCTGCATT
TTTGTGTTCTTTTATCTCTGGCTCTTTGCTAAAAATCCCTAGATCTGGCTGCAGGTATACGGAAGGGGCTTTGTTTTTAAGGCGAAGCAGTCAAGCACTGCCTCATATACAAGTTCATTTGCAAATCC
AATCATCATCCAGCATGCTAAGTCCTGTAATTCCCTCTAATATGGAGTCAGCTGCATTGGGGACACCATGGGACCGCAGGTAGACAGCATGAAGCAATTGTCCTCTCAGATTTGACAGATCCGTGATA
GAGATAATAATCCCCACATCTATCGGTACTTGCCCAAACCTATCTGTGCCACCCCA

hide sequence

RefSeq Acc Id:

XM_039109447 ⟹ XP_038965375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	79,478,821 - 79,600,031 (+)	NCBI
mRatBN7.2	5	74,683,902 - 74,805,113 (+)	NCBI

RefSeq Acc Id:

XM_063287322 ⟹ XP_063143392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	79,478,804 - 79,600,045 (+)	NCBI

RefSeq Acc Id:

XM_063287323 ⟹ XP_063143393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	79,478,820 - 79,591,600 (+)	NCBI

RefSeq Acc Id:

XM_063287324 ⟹ XP_063143394

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	79,478,808 - 79,608,118 (+)	NCBI


Protein RefSeqs	NP_001100121	(Get FASTA)	NCBI Sequence Viewer
	XP_038965375	(Get FASTA)	NCBI Sequence Viewer
	XP_063143392	(Get FASTA)	NCBI Sequence Viewer
	XP_063143393	(Get FASTA)	NCBI Sequence Viewer
	XP_063143394	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91629	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056176
	ENSRNOP00000056176.4
	ENSRNOP00000069076.1
	ENSRNOP00000079165.1
	ENSRNOP00000102520
	ENSRNOP00000107590
	ENSRNOP00000109497

RefSeq Acc Id:

NP_001100121 ⟸ NM_001106651

- UniProtKB:

D4A060 (UniProtKB/TrEMBL), A6KDX6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGGPPKALPSTGPQSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVTVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYS
VRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLTRVGESVKHVTGGYKLRSRPLEFAAIGDYLDTFALKL
GTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDITEEFLPVLREYILYSDSMKGVLKKRDQVHAEYEAKLEAVALRKEDRPKVPADVEKCQDRMECFNA
DLKADMERWQGNKRNDFRQLLVGLADKNIQYYEKCLMAWESIIPLLQEKQEAK

hide sequence

Ensembl Acc Id:

ENSRNOP00000056176 ⟸ ENSRNOT00000059419

Ensembl Acc Id:

ENSRNOP00000069076 ⟸ ENSRNOT00000087254

RefSeq Acc Id:	XP_038965375 ⟸ XM_039109447
- Peptide Label:	isoform X4
- UniProtKB:	D4A060 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079165 ⟸ ENSRNOT00000108184

Protein Domains

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JUF2-F1-model_v2	AlphaFold	A0A0G2JUF2	1-470	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693773

Promoter ID:

EPDNEW_R4298

Type:

initiation region

Name:

Snx30_1

Description:

sorting nexin family member 30

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	77,052,479 - 77,052,539	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41134	BioCyc
Ensembl Genes	ENSRNOG00000017132	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059419	ENTREZGENE
	ENSRNOT00000059419.5	UniProtKB/TrEMBL
	ENSRNOT00000087254.2	UniProtKB/TrEMBL
	ENSRNOT00000108184.1	UniProtKB/TrEMBL
	ENSRNOT00000156988	ENTREZGENE
	ENSRNOT00000157957	ENTREZGENE
	ENSRNOT00000161925	ENTREZGENE
Gene3D-CATH	1.20.1270.60	UniProtKB/TrEMBL
	3.30.1520.10	UniProtKB/TrEMBL
InterPro	AH/BAR-dom	UniProtKB/TrEMBL
	Phox	UniProtKB/TrEMBL
	PX_dom_sf	UniProtKB/TrEMBL
	SNX30	UniProtKB/TrEMBL
KEGG Report	rno:298033	UniProtKB/TrEMBL
NCBI Gene	298033	ENTREZGENE
PANTHER	PTHR45949:SF1	UniProtKB/TrEMBL
	SORTING NEXIN-4	UniProtKB/TrEMBL
Pfam	PF00787	UniProtKB/TrEMBL
PhenoGen	Snx30	PhenoGen
PROSITE	PS50195	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017132	RatGTEx
SMART	SM00312	UniProtKB/TrEMBL
Superfamily-SCOP	64268	UniProtKB/TrEMBL
	SSF103657	UniProtKB/TrEMBL
UniProt	A0A0G2JUF2_RAT	UniProtKB/TrEMBL
	A0A8I5ZMF9_RAT	UniProtKB/TrEMBL
	A6KDX6	ENTREZGENE, UniProtKB/TrEMBL
	D4A060	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Snx30	sorting nexin family member 30	Snx30_predicted	sorting nexin family member 30 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Snx30_predicted	sorting nexin family member 30 (predicted)	RGD1311367_predicted	similar to Sorting nexin 7 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1311367_predicted	similar to Sorting nexin 7 (predicted)	LOC298033_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298033_predicted	similar to Sorting nexin 7 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message