Symbol:
Trpm5
Name:
transient receptor potential cation channel, subfamily M, member 5
RGD ID:
1310620
Description:
Predicted to enable calcium-activated cation channel activity; potassium channel activity; and sodium channel activity. Predicted to be involved in metal ion transport; monoatomic cation transmembrane transport; and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Predicted to act upstream of or within monoatomic ion transmembrane transport. Located in dendrite and neuronal cell body. Orthologous to human TRPM5 (transient receptor potential cation channel subfamily M member 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC365391; transient receptor potential cation channel subfamily M member 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TRPM5 (transient receptor potential cation channel subfamily M member 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Trpm5 (transient receptor potential cation channel, subfamily M, member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Trpm5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TRPM5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TRPM5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Trpm5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TRPM5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TRPM5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Trpm5 (transient receptor potential cation channel subfamily M member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KCTD11 (potassium channel tetramerization domain containing 11) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TRPM5 (transient receptor potential cation channel subfamily M member 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trpm5 (transient receptor potential cation channel, subfamily M, member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm5 (transient receptor potential cation channel, subfamily M, member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 207,684,811 - 207,707,380 (-) NCBI GRCr8 mRatBN7.2 1 198,254,956 - 198,277,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 198,255,723 - 198,277,654 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 206,634,645 - 206,651,758 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 213,720,702 - 213,737,803 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 206,394,859 - 206,411,960 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 216,256,653 - 216,281,504 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 216,257,820 - 216,274,930 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 223,118,600 - 223,141,136 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 203,347,410 - 203,364,520 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 203,500,862 - 203,517,973 (-) NCBI Celera 1 195,824,918 - 195,842,028 (-) NCBI Celera Cytogenetic Map 1 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trpm5 Rat (1->4)-beta-D-glucan multiple interactions ISO Trpm5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRPM5 mRNA CTD PMID:36331819 Trpm5 Rat 1,2-dimethylhydrazine decreases expression ISO Trpm5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TRPM5 mRNA CTD PMID:22206623 Trpm5 Rat 17beta-estradiol increases expression ISO TRPM5 (Homo sapiens) 6480464 Estradiol results in increased expression of TRPM5 mRNA CTD PMID:31614463 Trpm5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRPM5 mRNA CTD PMID:33387578 Trpm5 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Trpm5 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Trpm5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TRPM5 mRNA CTD PMID:20188158 Trpm5 Rat 4,4'-diaminodiphenylmethane increases expression ISO Trpm5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TRPM5 mRNA CTD PMID:18648102 Trpm5 Rat 9-phenanthrol decreases activity ISO TRPM5 (Homo sapiens) 6480464 9-phenanthrol results in decreased activity of TRPM5 protein CTD PMID:18297105 Trpm5 Rat benzo[a]pyrene decreases expression ISO Trpm5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TRPM5 mRNA CTD PMID:20713471 Trpm5 Rat benzo[a]pyrene affects methylation ISO TRPM5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TRPM5 promoter CTD PMID:27901495 Trpm5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRPM5 mRNA CTD PMID:25181051 and PMID:34947998 Trpm5 Rat bisphenol A increases methylation ISO Trpm5 (Mus musculus) 6480464 bisphenol A results in increased methylation of TRPM5 promoter CTD PMID:27312807 Trpm5 Rat copper atom affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to Copper CTD PMID:19244541 Trpm5 Rat copper(0) affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to Copper CTD PMID:19244541 Trpm5 Rat copper(II) sulfate affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to Copper Sulfate CTD PMID:19244541 Trpm5 Rat diazinon increases methylation ISO TRPM5 (Homo sapiens) 6480464 Diazinon results in increased methylation of TRPM5 gene CTD PMID:22964155 Trpm5 Rat disodium selenite decreases expression ISO TRPM5 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of TRPM5 mRNA CTD PMID:18175754 Trpm5 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TRPM5 mRNA CTD PMID:33387578 Trpm5 Rat iron(2+) sulfate (anhydrous) affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to ferrous sulfate CTD PMID:19244541 Trpm5 Rat magnesium sulfate affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to Magnesium Sulfate CTD PMID:19244541 Trpm5 Rat methotrexate affects expression ISO Trpm5 (Mus musculus) 6480464 Methotrexate affects the expression of TRPM5 mRNA CTD PMID:18502557 Trpm5 Rat paracetamol decreases expression ISO TRPM5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TRPM5 mRNA CTD PMID:22230336 Trpm5 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TRPM5 mRNA CTD PMID:33387578 Trpm5 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Trpm5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRPM5 mRNA CTD PMID:36331819 Trpm5 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of TRPM5 mRNA CTD PMID:28511854 Trpm5 Rat sodium arsenite increases expression ISO TRPM5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TRPM5 mRNA CTD PMID:38568856 Trpm5 Rat thiram increases expression ISO TRPM5 (Homo sapiens) 6480464 Thiram results in increased expression of TRPM5 mRNA CTD PMID:38568856 Trpm5 Rat titanium dioxide increases expression ISO Trpm5 (Mus musculus) 6480464 titanium dioxide results in increased expression of TRPM5 mRNA CTD PMID:35295148 Trpm5 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TRPM5 mRNA CTD PMID:33387578 Trpm5 Rat triclosan increases expression ISO TRPM5 (Homo sapiens) 6480464 Triclosan results in increased expression of TRPM5 mRNA CTD PMID:30510588 Trpm5 Rat valproic acid increases methylation ISO TRPM5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TRPM5 gene CTD PMID:29154799 Trpm5 Rat zinc sulfate affects response to substance ISO Trpm5 (Mus musculus) 6480464 TRPM5 protein affects the susceptibility to Zinc Sulfate CTD PMID:19244541
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 9-phenanthrol (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) diazinon (ISO) disodium selenite (ISO) gentamycin (EXP) iron(2+) sulfate (anhydrous) (ISO) magnesium sulfate (ISO) methotrexate (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) sodium arsenite (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) valproic acid (ISO) zinc sulfate (ISO)
Trpm5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 207,684,811 - 207,707,380 (-) NCBI GRCr8 mRatBN7.2 1 198,254,956 - 198,277,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 198,255,723 - 198,277,654 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 206,634,645 - 206,651,758 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 213,720,702 - 213,737,803 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 206,394,859 - 206,411,960 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 216,256,653 - 216,281,504 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 216,257,820 - 216,274,930 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 223,118,600 - 223,141,136 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 203,347,410 - 203,364,520 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 203,500,862 - 203,517,973 (-) NCBI Celera 1 195,824,918 - 195,842,028 (-) NCBI Celera Cytogenetic Map 1 q42 NCBI
TRPM5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 2,403,991 - 2,444,514 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 2,404,515 - 2,444,514 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 2,425,745 - 2,465,744 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 2,382,336 - 2,400,851 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 2,382,335 - 2,400,851 NCBI Celera 11 2,460,552 - 2,479,085 (-) NCBI Celera Cytogenetic Map 11 p15.5 NCBI HuRef 11 2,216,098 - 2,234,573 (-) NCBI HuRef CHM1_1 11 2,424,619 - 2,443,104 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 2,493,342 - 2,533,837 (-) NCBI T2T-CHM13v2.0
Trpm5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 142,625,266 - 142,648,379 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 142,622,890 - 142,648,379 (-) Ensembl GRCm39 Ensembl GRCm38 7 143,071,529 - 143,094,642 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 143,069,153 - 143,094,642 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 150,257,434 - 150,280,547 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 142,881,182 - 142,898,998 (-) NCBI MGSCv36 mm8 Celera 7 142,827,134 - 142,850,247 (-) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 88.11 NCBI
Trpm5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 14,180,475 - 14,196,955 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 14,180,067 - 14,202,041 (-) NCBI ChiLan1.0 ChiLan1.0
TRPM5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 4,813,919 - 4,833,205 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 4,025,616 - 4,045,143 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 2,428,185 - 2,448,070 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 2,456,418 - 2,475,989 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 2,456,831 - 2,475,989 (-) Ensembl panpan1.1 panPan2
TRPM5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 46,479,397 - 46,493,279 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 46,478,759 - 46,498,043 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 45,088,553 - 45,102,905 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 47,158,489 - 47,172,841 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 47,159,262 - 47,176,099 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 46,606,399 - 46,620,664 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 46,187,007 - 46,201,359 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 46,934,044 - 46,948,396 (-) NCBI UU_Cfam_GSD_1.0
Trpm5
TRPM5
TRPM5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 2,219,427 - 2,239,833 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 2,219,852 - 2,238,454 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 99,420,803 - 99,438,961 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trpm5
.
Assembly: mRatBN7.2 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 71 Interacting mature miRNAs: 73 Transcripts: ENSRNOT00000040850 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6480783 Insul19 Insulin level QTL 19 4.33 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 197489281 200611765 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
UniSTS:496001
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 198,272,553 - 198,273,041 (+) MAPPER mRatBN7.2 Rnor_6.0 1 216,274,354 - 216,274,841 NCBI Rnor6.0 Rnor_5.0 1 223,135,985 - 223,136,472 UniSTS Rnor5.0 RGSC_v3.4 1 203,363,944 - 203,364,431 UniSTS RGSC3.4 Celera 1 195,841,452 - 195,841,939 UniSTS Cytogenetic Map 1 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
5
49
104
90
89
58
25
58
6
211
94
84
45
54
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040850 ⟹ ENSRNOP00000039981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 198,255,723 - 198,274,820 (-) Ensembl Rnor_6.0 Ensembl 1 216,257,820 - 216,274,930 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103945 ⟹ ENSRNOP00000091726
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 198,255,723 - 198,277,654 (-) Ensembl
RefSeq Acc Id:
NM_001191896 ⟹ NP_001178825
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,685,157 - 207,707,088 (-) NCBI mRatBN7.2 1 198,255,723 - 198,277,654 (-) NCBI Rnor_6.0 1 216,257,820 - 216,274,930 (-) NCBI Rnor_5.0 1 223,118,600 - 223,141,136 (-) NCBI Celera 1 195,824,918 - 195,842,028 (-) NCBI
Sequence:
ATGCCGATGGCCCAGAGCTCTTGTCCTGGAAGCCCCCCAGATACTGGGGATGGATGGGAGCCAGTCCTATGCAAGGGAGAGGTCAACTTCGGAGGGTCTGGGAAAAAGCGAAGCAAGTTTGTGAAGGT
hide sequence
RefSeq Acc Id:
XM_039085432 ⟹ XP_038941360
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,684,811 - 207,705,212 (-) NCBI mRatBN7.2 1 198,254,956 - 198,275,773 (-) NCBI
RefSeq Acc Id:
XM_039085435 ⟹ XP_038941363
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,687,882 - 207,707,380 (-) NCBI mRatBN7.2 1 198,258,457 - 198,277,824 (-) NCBI
RefSeq Acc Id:
NP_001178825 ⟸ NM_001191896
- UniProtKB:
A0A8I6AG64 (UniProtKB/TrEMBL), A0A455XI77 (UniProtKB/TrEMBL)
- Sequence:
MPMAQSSCPGSPPDTGDGWEPVLCKGEVNFGGSGKKRSKFVKVPSNVAPSMLFELLLTEWHLPAPNLVVSLVGEERLFAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAVRDHSLAST
hide sequence
Ensembl Acc Id:
ENSRNOP00000039981 ⟸ ENSRNOT00000040850
RefSeq Acc Id:
XP_038941360 ⟸ XM_039085432
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AG64 (UniProtKB/TrEMBL), A0A455XI77 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941363 ⟸ XM_039085435
- Peptide Label:
isoform X2
- UniProtKB:
A6HYA7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091726 ⟸ ENSRNOT00000103945
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Trpm5
transient receptor potential cation channel, subfamily M, member 5
Trpm5_predicted
transient receptor potential cation channel, subfamily M, member 5 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Trpm5_predicted
transient receptor potential cation channel, subfamily M, member 5 (predicted)
Symbol and Name status set to approved
70820 APPROVED
