Symbol:
Tdrd3
Name:
tudor domain containing 3
RGD ID:
1310126
Description:
Predicted to enable chromatin binding activity; methylated histone binding activity; and transcription coactivator activity. Predicted to be involved in chromatin organization and positive regulation of DNA-templated transcription. Predicted to be located in Golgi apparatus; cytosol; and nucleoplasm. Predicted to be part of DNA topoisomerase III-beta-TDRD3 complex and exon-exon junction complex. Predicted to be active in nucleus. Orthologous to human TDRD3 (tudor domain containing 3); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC306066; tudor domain-containing protein 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TDRD3 (tudor domain containing 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Tdrd3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tdrd3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TDRD3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TDRD3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tdrd3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TDRD3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TDRD3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tdrd3 (tudor domain containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TDRD3 (tudor domain containing 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tdrd3 (tudor domain containing 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tdrd3 (tudor domain containing 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y50D4C.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Tdrd3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tdrd3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 69,748,754 - 69,911,605 (+) NCBI GRCr8 mRatBN7.2 15 63,340,531 - 63,497,208 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 63,341,235 - 63,476,110 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 67,449,294 - 67,576,546 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 68,534,799 - 68,662,049 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 65,431,929 - 65,566,762 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 70,732,164 - 70,864,855 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 70,790,125 - 70,859,185 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 74,335,410 - 74,468,101 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 69,605,244 - 69,739,566 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 69,621,023 - 69,755,345 (+) NCBI Celera 15 62,845,891 - 62,979,450 (+) NCBI Celera Cytogenetic Map 15 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tdrd3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TDRD3 mRNA CTD PMID:22079256 Tdrd3 Rat 1,2-dichloroethane decreases expression ISO Tdrd3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TDRD3 mRNA CTD PMID:28960355 Tdrd3 Rat 1,2-dimethylhydrazine affects expression ISO Tdrd3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of TDRD3 mRNA CTD PMID:22206623 Tdrd3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tdrd3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TDRD3 mRNA CTD PMID:21570461 Tdrd3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TDRD3 mRNA CTD PMID:33387578 Tdrd3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TDRD3 mRNA CTD PMID:32109520 Tdrd3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Tdrd3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TDRD3 mRNA CTD PMID:21346803 Tdrd3 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of TDRD3 mRNA CTD PMID:21346803 Tdrd3 Rat 5-aza-2'-deoxycytidine affects expression ISO TDRD3 (Homo sapiens) 6480464 Decitabine affects the expression of TDRD3 mRNA CTD PMID:23300844 Tdrd3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TDRD3 mRNA CTD PMID:28959563 Tdrd3 Rat all-trans-retinoic acid decreases expression ISO TDRD3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TDRD3 mRNA CTD PMID:15498508 and PMID:33167477 Tdrd3 Rat antirheumatic drug increases expression ISO TDRD3 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of TDRD3 mRNA CTD PMID:24449571 Tdrd3 Rat aristolochic acid A decreases expression ISO TDRD3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TDRD3 mRNA CTD PMID:33212167 Tdrd3 Rat arsenite(3-) increases methylation ISO TDRD3 (Homo sapiens) 6480464 arsenite results in increased methylation of TDRD3 promoter CTD PMID:23974009 Tdrd3 Rat benzo[a]pyrene multiple interactions ISO Tdrd3 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to TDRD3 promoter] CTD PMID:19654925 Tdrd3 Rat benzo[a]pyrene affects methylation ISO TDRD3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TDRD3 intron CTD PMID:30157460 Tdrd3 Rat benzo[a]pyrene decreases methylation ISO Tdrd3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TDRD3 intron CTD PMID:27901495 Tdrd3 Rat benzo[a]pyrene increases expression ISO Tdrd3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TDRD3 mRNA CTD PMID:22228805 Tdrd3 Rat benzo[a]pyrene decreases expression ISO Tdrd3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TDRD3 mRNA CTD PMID:22228805 Tdrd3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TDRD3 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Tdrd3 Rat benzo[e]pyrene decreases methylation ISO TDRD3 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of TDRD3 intron CTD PMID:30157460 Tdrd3 Rat beta-lapachone increases expression ISO TDRD3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of TDRD3 mRNA CTD PMID:38218311 Tdrd3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TDRD3 mRNA CTD PMID:25181051 Tdrd3 Rat butanal decreases expression ISO TDRD3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of TDRD3 mRNA CTD PMID:26079696 Tdrd3 Rat caffeine affects phosphorylation ISO TDRD3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TDRD3 protein CTD PMID:35688186 Tdrd3 Rat carbon nanotube decreases expression ISO Tdrd3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of TDRD3 mRNA CTD PMID:25554681 Tdrd3 Rat CGP 52608 multiple interactions ISO TDRD3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TDRD3 gene] CTD PMID:28238834 Tdrd3 Rat chrysene increases expression ISO Tdrd3 (Mus musculus) 6480464 chrysene results in increased expression of TDRD3 mRNA CTD PMID:26377693 Tdrd3 Rat cisplatin affects expression ISO TDRD3 (Homo sapiens) 6480464 Cisplatin affects the expression of TDRD3 mRNA CTD PMID:23300844 Tdrd3 Rat coumarin increases phosphorylation ISO TDRD3 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of TDRD3 protein CTD PMID:35688186 Tdrd3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TDRD3 mRNA CTD PMID:27523638 Tdrd3 Rat cyclosporin A decreases methylation ISO TDRD3 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of TDRD3 promoter CTD PMID:27989131 Tdrd3 Rat dicrotophos decreases expression ISO TDRD3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of TDRD3 mRNA CTD PMID:28302478 Tdrd3 Rat disodium selenite increases expression ISO TDRD3 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of TDRD3 mRNA CTD PMID:18175754 Tdrd3 Rat dorsomorphin multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tdrd3 Rat doxorubicin decreases expression ISO TDRD3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TDRD3 mRNA CTD PMID:29803840 Tdrd3 Rat etoposide affects response to substance ISO TDRD3 (Homo sapiens) 6480464 TDRD3 protein affects the susceptibility to Etoposide CTD PMID:16217747 Tdrd3 Rat formaldehyde decreases expression ISO TDRD3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TDRD3 mRNA CTD PMID:23649840 Tdrd3 Rat FR900359 affects phosphorylation ISO TDRD3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TDRD3 protein CTD PMID:37730182 Tdrd3 Rat methapyrilene decreases methylation ISO TDRD3 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of TDRD3 intron CTD PMID:30157460 Tdrd3 Rat methotrexate increases expression ISO TDRD3 (Homo sapiens) 6480464 Methotrexate results in increased expression of TDRD3 mRNA CTD PMID:24449571 Tdrd3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TDRD3 gene CTD PMID:35440735 Tdrd3 Rat mitomycin C affects response to substance ISO TDRD3 (Homo sapiens) 6480464 TDRD3 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Tdrd3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TDRD3 mRNA CTD PMID:25729387 Tdrd3 Rat paracetamol affects expression ISO Tdrd3 (Mus musculus) 6480464 Acetaminophen affects the expression of TDRD3 mRNA CTD PMID:17562736 Tdrd3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TDRD3 mRNA CTD PMID:33387578 Tdrd3 Rat paracetamol decreases expression ISO TDRD3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TDRD3 mRNA CTD PMID:22230336 Tdrd3 Rat perfluorohexanesulfonic acid increases expression ISO Tdrd3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of TDRD3 mRNA CTD PMID:37995155 Tdrd3 Rat phenylmercury acetate decreases expression ISO TDRD3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of TDRD3 mRNA CTD PMID:26272509 Tdrd3 Rat phenylmercury acetate multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TDRD3 mRNA CTD PMID:27188386 Tdrd3 Rat potassium chromate decreases expression ISO TDRD3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TDRD3 mRNA CTD PMID:22079256 Tdrd3 Rat potassium chromate multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TDRD3 mRNA CTD PMID:22079256 Tdrd3 Rat quercetin decreases expression ISO TDRD3 (Homo sapiens) 6480464 Quercetin results in decreased expression of TDRD3 mRNA CTD PMID:21632981 Tdrd3 Rat quercetin increases phosphorylation ISO TDRD3 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of TDRD3 protein CTD PMID:35688186 Tdrd3 Rat SB 431542 multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tdrd3 Rat sodium arsenite decreases expression ISO TDRD3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TDRD3 mRNA CTD PMID:38568856 Tdrd3 Rat tamibarotene decreases expression ISO TDRD3 (Homo sapiens) 6480464 tamibarotene results in decreased expression of TDRD3 mRNA CTD PMID:15498508 Tdrd3 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TDRD3 mRNA CTD PMID:31150632 Tdrd3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TDRD3 mRNA CTD PMID:34492290 Tdrd3 Rat titanium dioxide decreases methylation ISO Tdrd3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TDRD3 gene CTD PMID:35295148 Tdrd3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TDRD3 mRNA CTD PMID:25729387 Tdrd3 Rat triphenyl phosphate affects expression ISO TDRD3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TDRD3 mRNA CTD PMID:37042841 Tdrd3 Rat triptonide decreases expression ISO Tdrd3 (Mus musculus) 6480464 triptonide results in decreased expression of TDRD3 mRNA CTD PMID:33045310 Tdrd3 Rat valproic acid decreases methylation ISO TDRD3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TDRD3 gene CTD PMID:29154799 Tdrd3 Rat valproic acid multiple interactions ISO TDRD3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TDRD3 mRNA CTD PMID:27188386 Tdrd3 Rat valproic acid decreases expression ISO TDRD3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TDRD3 mRNA CTD PMID:23179753 more ... Tdrd3 Rat valproic acid decreases expression ISO Tdrd3 (Mus musculus) 6480464 Valproic Acid results in decreased expression of TDRD3 mRNA CTD PMID:21427059 Tdrd3 Rat valproic acid affects expression ISO TDRD3 (Homo sapiens) 6480464 Valproic Acid affects the expression of TDRD3 mRNA CTD PMID:25979313 Tdrd3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TDRD3 mRNA CTD PMID:23034163
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dinitrotoluene (EXP) 4-amino-2,6-dinitrotoluene (EXP) 5-aza-2'-deoxycytidine (ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP) butanal (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chrysene (ISO) cisplatin (ISO) coumarin (ISO) Cuprizon (EXP) cyclosporin A (ISO) dicrotophos (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) etoposide (ISO) formaldehyde (ISO) FR900359 (ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) mitomycin C (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) quercetin (ISO) SB 431542 (ISO) sodium arsenite (ISO) tamibarotene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Tdrd3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 69,748,754 - 69,911,605 (+) NCBI GRCr8 mRatBN7.2 15 63,340,531 - 63,497,208 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 63,341,235 - 63,476,110 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 67,449,294 - 67,576,546 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 68,534,799 - 68,662,049 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 65,431,929 - 65,566,762 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 70,732,164 - 70,864,855 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 70,790,125 - 70,859,185 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 74,335,410 - 74,468,101 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 69,605,244 - 69,739,566 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 69,621,023 - 69,755,345 (+) NCBI Celera 15 62,845,891 - 62,979,450 (+) NCBI Celera Cytogenetic Map 15 q12 NCBI
TDRD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 60,395,533 - 60,573,879 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 60,396,457 - 60,573,878 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 60,970,591 - 61,148,013 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 59,911,823 - 60,046,012 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 59,869,122 - 60,046,012 NCBI Celera 13 41,929,733 - 42,107,133 (+) NCBI Celera Cytogenetic Map 13 q21.2 NCBI HuRef 13 41,662,317 - 41,839,768 (+) NCBI HuRef CHM1_1 13 60,938,267 - 61,115,685 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 59,615,225 - 59,793,547 (+) NCBI T2T-CHM13v2.0
Tdrd3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 87,647,598 - 87,782,944 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 87,654,075 - 87,782,940 (+) Ensembl GRCm39 Ensembl GRCm38 14 87,416,178 - 87,545,508 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 87,416,639 - 87,545,504 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 87,816,390 - 87,945,315 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 86,248,429 - 86,377,251 (+) NCBI MGSCv36 mm8 Celera 14 84,929,172 - 85,068,169 (+) NCBI Celera Cytogenetic Map 14 E1 NCBI cM Map 14 44.17 NCBI
Tdrd3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 44,328,795 - 44,457,784 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 44,329,159 - 44,457,958 (-) NCBI ChiLan1.0 ChiLan1.0
TDRD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 61,913,781 - 62,095,454 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 60,505,859 - 60,687,137 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 41,568,080 - 41,750,288 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 60,289,702 - 60,470,245 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 60,290,518 - 60,470,245 (+) Ensembl panpan1.1 panPan2
TDRD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 16,287,721 - 16,449,842 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 16,288,473 - 16,444,635 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 16,265,095 - 16,427,920 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 16,524,378 - 16,687,132 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 16,525,132 - 16,687,126 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 16,224,234 - 16,386,787 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 16,249,914 - 16,412,810 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 16,264,401 - 16,386,815 (+) NCBI UU_Cfam_GSD_1.0
Tdrd3
TDRD3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 33,258,063 - 33,440,123 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 33,257,556 - 33,440,131 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 34,988,674 - 35,171,255 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TDRD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 38,174,141 - 38,361,626 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 38,174,990 - 38,361,622 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 5,331,867 - 5,524,367 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tdrd3
.
Predicted Target Of
Count of predictions: 145 Count of miRNA genes: 117 Interacting mature miRNAs: 124 Transcripts: ENSRNOT00000012440 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 724545 Niddm54 Non-insulin dependent diabetes mellitus QTL 54 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 50794494 73699215 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 2293686 Bmd36 Bone mineral density QTL 36 7.4 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 15 33611058 71477291 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 2293691 Bmd37 Bone mineral density QTL 37 6.6 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 15 33611058 71477291 Rat 2317050 Aia24 Adjuvant induced arthritis QTL 24 2.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 52847908 73690657 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 2313080 Bss65 Bone structure and strength QTL 65 3.9 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 15 60990468 73690657 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
RH132759
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 63,446,011 - 63,446,191 (+) MAPPER mRatBN7.2 Rnor_6.0 15 70,834,287 - 70,834,466 NCBI Rnor6.0 Rnor_5.0 15 74,437,533 - 74,437,712 UniSTS Rnor5.0 RGSC_v3.4 15 69,708,829 - 69,709,008 UniSTS RGSC3.4 RGSC_v3.4 15 69,928,252 - 69,928,431 UniSTS RGSC3.4 Celera 15 63,091,098 - 63,091,277 UniSTS Celera 15 62,949,353 - 62,949,532 UniSTS Cytogenetic Map 15 q12 UniSTS
BE119407
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 63,426,170 - 63,426,322 (+) MAPPER mRatBN7.2 Rnor_6.0 15 70,816,222 - 70,816,373 NCBI Rnor6.0 Rnor_5.0 15 74,419,468 - 74,419,619 UniSTS Rnor5.0 Celera 15 62,930,012 - 62,930,163 UniSTS RH 3.4 Map 15 385.47 UniSTS Cytogenetic Map 15 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012440 ⟹ ENSRNOP00000012440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 63,341,268 - 63,476,094 (+) Ensembl Rnor_6.0 Ensembl 15 70,790,125 - 70,859,185 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110490 ⟹ ENSRNOP00000083043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 63,341,235 - 63,476,097 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117994 ⟹ ENSRNOP00000077267
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 63,341,268 - 63,476,094 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119103 ⟹ ENSRNOP00000086500
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 63,341,235 - 63,476,110 (+) Ensembl
RefSeq Acc Id:
NM_001012043 ⟹ NP_001012043
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,749,830 - 69,884,657 (+) NCBI mRatBN7.2 15 63,341,268 - 63,476,097 (+) NCBI Rnor_6.0 15 70,732,164 - 70,864,855 (+) NCBI Rnor_5.0 15 74,335,410 - 74,468,101 (+) NCBI RGSC_v3.4 15 69,605,244 - 69,739,566 (+) RGD Celera 15 62,845,891 - 62,979,450 (+) RGD
Sequence:
CACAGTCGAACAGAGGAGTTTTTTTTCTTTTTCTTTTCTTTCTTCTTTTTTCTCTCTTTCTTCTTTTTCTTTTTTCTGGGTCTCCAGCAGGAGGCCTGTCCCCCACCCTCAGTTCAGACCCCCGCCGT
hide sequence
RefSeq Acc Id:
XM_039093361 ⟹ XP_038949289
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,756 - 69,884,657 (+) NCBI mRatBN7.2 15 63,340,532 - 63,476,099 (+) NCBI
RefSeq Acc Id:
XM_039093362 ⟹ XP_038949290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,755 - 69,911,605 (+) NCBI mRatBN7.2 15 63,340,531 - 63,497,208 (+) NCBI
RefSeq Acc Id:
XM_039093365 ⟹ XP_038949293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,756 - 69,884,657 (+) NCBI mRatBN7.2 15 63,340,532 - 63,476,099 (+) NCBI
RefSeq Acc Id:
XM_063274315 ⟹ XP_063130385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,754 - 69,878,996 (+) NCBI
RefSeq Acc Id:
XR_005493732
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,757 - 69,878,995 (+) NCBI mRatBN7.2 15 63,340,533 - 63,470,435 (+) NCBI
RefSeq Acc Id:
XR_005493733
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 69,748,757 - 69,863,237 (+) NCBI mRatBN7.2 15 63,340,533 - 63,454,661 (+) NCBI
RefSeq Acc Id:
NP_001012043 ⟸ NM_001012043
- UniProtKB:
Q66HC1 (UniProtKB/Swiss-Prot), A0A096MIS7 (UniProtKB/TrEMBL)
- Sequence:
MLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDSNTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASTVQVDSRELDRRKTLQVSLPAKPTNDND
hide sequence
Ensembl Acc Id:
ENSRNOP00000012440 ⟸ ENSRNOT00000012440
RefSeq Acc Id:
XP_038949290 ⟸ XM_039093362
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZYD3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949289 ⟸ XM_039093361
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038949293 ⟸ XM_039093365
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000086500 ⟸ ENSRNOT00000119103
Ensembl Acc Id:
ENSRNOP00000083043 ⟸ ENSRNOT00000110490
Ensembl Acc Id:
ENSRNOP00000077267 ⟸ ENSRNOT00000117994
RefSeq Acc Id:
XP_063130385 ⟸ XM_063274315
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A6B7 (UniProtKB/TrEMBL), A0A8I5ZYD3 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-12928 BioCyc
Ensembl Genes ENSRNOG00000009034 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000012440.8 UniProtKB/TrEMBL
ENSRNOT00000110490.1 UniProtKB/TrEMBL
ENSRNOT00000117994.1 UniProtKB/Swiss-Prot
ENSRNOT00000119103.1 UniProtKB/TrEMBL
Gene3D-CATH 2.30.30.140 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.40.50.770 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
DNA helicase RuvA subunit, C-terminal domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7113366 IMAGE-MGC_LOAD
InterPro RMI1_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RMI1_N_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Tudor UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Tudor_TDRD3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA-like_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA_TDRD3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:306066 UniProtKB/Swiss-Prot
MGC_CLONE MGC:93931 IMAGE-MGC_LOAD
NCBI Gene 306066 ENTREZGENE
PANTHER SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TUDOR DOMAIN-CONTAINING PROTEIN 3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam RMI1_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TUDOR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA_7 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Tdrd3 PhenoGen
PROSITE TUDOR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000009034 RatGTEx
SMART DUF1767 UniProtKB/TrEMBL
TUDOR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UBA UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF46934 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Tudor/PWWP/MBT UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A096MIS7 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZYD3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A6B7 ENTREZGENE, UniProtKB/TrEMBL
Q66HC1 ENTREZGENE, UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Tdrd3
tudor domain containing 3
Tdrd3_predicted
tudor domain containing 3 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tdrd3_predicted
tudor domain containing 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
