Symbol:
Tada2a
Name:
transcriptional adaptor 2A
RGD ID:
1309959
Description:
Predicted to enable chromatin binding activity and transcription coactivator activity. Predicted to contribute to histone acetyltransferase activity. Predicted to be involved in several processes, including regulation of cell division; regulation of embryonic development; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including chromatin organization; regulation of protein modification process; and regulation of protein stability. Predicted to be located in mitotic spindle. Predicted to be part of ATAC complex and SAGA complex. Predicted to be active in nucleus. Orthologous to human TADA2A (transcriptional adaptor 2A); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ADA2-like protein; LOC360581; Tada2l; transcriptional adapter 2-alpha; transcriptional adapter 2-like; transcriptional adaptor 2 (ADA2 homolog, yeast)-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TADA2A (transcriptional adaptor 2A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):
Tada2a (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tada2a (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TADA2A (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TADA2A (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tada2a (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TADA2A (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TADA2A (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tada2a (transcriptional adaptor 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TADA2A (transcriptional adaptor 2A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tada2a (transcriptional adaptor 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tada2a (transcriptional adaptor 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ada2a
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ADA2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tada2a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 69,463,966 - 69,511,612 (-) NCBI GRCr8 mRatBN7.2 10 68,966,502 - 69,014,149 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 68,966,502 - 69,014,105 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 73,586,475 - 73,634,083 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,091,491 - 73,139,094 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 68,555,914 - 68,603,517 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 71,393,701 - 71,441,435 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 71,393,692 - 71,441,389 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 71,307,409 - 71,354,792 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 72,365,950 - 72,413,305 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 72,380,321 - 72,427,675 (-) NCBI Celera 10 67,895,248 - 67,942,367 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tada2a Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1320582 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TADA2A mRNA CTD PMID:22079256 Tada2a Rat 1,2-dimethylhydrazine increases expression ISO RGD:1320583 6480464 1,2-Dimethylhydrazine results in increased expression of TADA2A mRNA CTD PMID:22206623 Tada2a Rat 17alpha-ethynylestradiol affects expression ISO RGD:1320583 6480464 Ethinyl Estradiol affects the expression of TADA2A mRNA CTD PMID:17555576 Tada2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1320583 6480464 Tetrachlorodibenzodioxin affects the expression of TADA2A mRNA CTD PMID:21570461 Tada2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TADA2A mRNA CTD PMID:26232522 Tada2a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of TADA2A mRNA CTD PMID:21346803 Tada2a Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1320582 6480464 Lactic Acid results in decreased expression of TADA2A mRNA CTD PMID:30851411 Tada2a Rat acrolein multiple interactions ISO RGD:1320582 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Tada2a Rat all-trans-retinoic acid decreases expression ISO RGD:1320582 6480464 Tretinoin results in decreased expression of TADA2A mRNA CTD PMID:33167477 Tada2a Rat alpha-pinene multiple interactions ISO RGD:1320582 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Tada2a Rat Aroclor 1254 decreases expression ISO RGD:1320583 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of TADA2A mRNA CTD PMID:23650126 Tada2a Rat benzo[a]pyrene increases expression ISO RGD:1320583 6480464 Benzo(a)pyrene results in increased expression of TADA2A mRNA CTD PMID:22228805 Tada2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TADA2A mRNA CTD PMID:25181051 Tada2a Rat bisphenol A decreases expression ISO RGD:1320583 6480464 bisphenol A results in decreased expression of TADA2A mRNA CTD PMID:32156529 Tada2a Rat bisphenol A affects methylation ISO RGD:1320583 6480464 bisphenol A affects the methylation of TADA2A promoter CTD PMID:27334623 Tada2a Rat bisphenol F decreases expression ISO RGD:1320583 6480464 bisphenol F results in decreased expression of TADA2A mRNA CTD PMID:38685157 Tada2a Rat cadmium dichloride decreases expression ISO RGD:1320582 6480464 Cadmium Chloride results in decreased expression of TADA2A mRNA CTD PMID:12160620|PMID:38568856 Tada2a Rat chlorpyrifos decreases expression ISO RGD:1320583 6480464 Chlorpyrifos results in decreased expression of TADA2A mRNA CTD PMID:37019170 Tada2a Rat chrysene increases expression ISO RGD:1320583 6480464 chrysene results in increased expression of TADA2A mRNA CTD PMID:26377693 Tada2a Rat ciguatoxin CTX1B affects expression ISO RGD:1320583 6480464 Ciguatoxins affects the expression of TADA2A mRNA CTD PMID:18353800 Tada2a Rat copper(II) sulfate increases expression ISO RGD:1320582 6480464 Copper Sulfate results in increased expression of TADA2A mRNA CTD PMID:19549813 Tada2a Rat DDE increases expression ISO RGD:1320582 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TADA2A mRNA CTD PMID:38568856 Tada2a Rat Dibutyl phosphate affects expression ISO RGD:1320582 6480464 di-n-butylphosphoric acid affects the expression of TADA2A mRNA CTD PMID:37042841 Tada2a Rat dibutyl phthalate decreases expression ISO RGD:1320583 6480464 Dibutyl Phthalate results in decreased expression of TADA2A mRNA CTD PMID:17361019|PMID:21266533 Tada2a Rat doxorubicin decreases expression ISO RGD:1320582 6480464 Doxorubicin results in decreased expression of TADA2A mRNA CTD PMID:29803840 Tada2a Rat FR900359 increases phosphorylation ISO RGD:1320582 6480464 FR900359 results in increased phosphorylation of TADA2A protein CTD PMID:37730182 Tada2a Rat iron dichloride decreases expression ISO RGD:1320582 6480464 ferrous chloride results in decreased expression of TADA2A mRNA CTD PMID:35984750 Tada2a Rat methylmercury chloride decreases expression ISO RGD:1320582 6480464 methylmercuric chloride results in decreased expression of TADA2A mRNA CTD PMID:28001369 Tada2a Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of TADA2A mRNA CTD PMID:25729387 Tada2a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TADA2A mRNA CTD PMID:25729387 Tada2a Rat ozone multiple interactions ISO RGD:1320582 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Tada2a Rat paracetamol affects expression ISO RGD:1320583 6480464 Acetaminophen affects the expression of TADA2A mRNA CTD PMID:17562736 Tada2a Rat potassium chromate decreases expression ISO RGD:1320582 6480464 potassium chromate(VI) results in decreased expression of TADA2A mRNA CTD PMID:22079256 Tada2a Rat potassium chromate multiple interactions ISO RGD:1320582 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TADA2A mRNA CTD PMID:22079256 Tada2a Rat rac-lactic acid decreases expression ISO RGD:1320582 6480464 Lactic Acid results in decreased expression of TADA2A mRNA CTD PMID:30851411 Tada2a Rat silicon dioxide decreases expression ISO RGD:1320582 6480464 Silicon Dioxide results in decreased expression of TADA2A mRNA CTD PMID:25351596 Tada2a Rat sodium arsenite increases expression ISO RGD:1320582 6480464 sodium arsenite results in increased expression of TADA2A mRNA CTD PMID:12760830 Tada2a Rat tamoxifen affects expression ISO RGD:1320583 6480464 Tamoxifen affects the expression of TADA2A mRNA CTD PMID:17555576 Tada2a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TADA2A mRNA CTD PMID:25729387 Tada2a Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TADA2A gene CTD PMID:27618143 Tada2a Rat trimellitic anhydride increases expression ISO RGD:1320583 6480464 trimellitic anhydride results in increased expression of TADA2A mRNA CTD PMID:19042947 Tada2a Rat triphenyl phosphate affects expression ISO RGD:1320582 6480464 triphenyl phosphate affects the expression of TADA2A mRNA CTD PMID:37042841 Tada2a Rat urethane decreases expression ISO RGD:1320582 6480464 Urethane results in decreased expression of TADA2A mRNA CTD PMID:28818685 Tada2a Rat valproic acid decreases expression ISO RGD:1320582 6480464 Valproic Acid results in decreased expression of TADA2A mRNA CTD PMID:26272509|PMID:28001369 Tada2a Rat vorinostat decreases expression ISO RGD:1320582 6480464 vorinostat results in decreased expression of TADA2A mRNA CTD PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Tada2a Rat chromatin binding enables IBA PANTHER:PTN000271860|SGD:S000002856 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Tada2a Rat DNA binding enables IEA UniProtKB-KW:KW-0238 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Tada2a Rat histone acetyltransferase activity contributes_to ISO RGD:1320582 1624291 PMID:9674425 RGD PMID:9674425 Tada2a Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Tada2a Rat protein binding enables ISO RGD:1320582 1624291 UniProtKB:A0A0S2Z3R2|UniProtKB:A0A0S2Z4A7|UniProtKB:A0A0S2Z4G9|UniProtKB:A0A0S2Z5X4|UniProtKB:O14964|UniProtKB:O60573|UniProtKB:O75431|UniProtKB:O75528|UniProtKB:O95363|UniProtKB:P25800|UniProtKB:P47897|UniProtKB:P52292|UniProtKB:P55081|UniProtKB:P61326|UniProtKB:Q12874|UniProtKB:Q13064|UniProtKB:Q16236|UniProtKB:Q17RB0|UniProtKB:Q2WGJ6|UniProtKB:Q5W150|UniProtKB:Q5W5X9|UniProtKB:Q68DK2-5|UniProtKB:Q6PEW1|UniProtKB:Q8IYX3|UniProtKB:Q8N5M4|UniProtKB:Q8TAU3|UniProtKB:Q8TBZ8|UniProtKB:Q8TD31-3|UniProtKB:Q8TES7-6|UniProtKB:Q8WW24|UniProtKB:Q8WWY3|UniProtKB:Q92830|UniProtKB:Q96A72|UniProtKB:Q96FV9|UniProtKB:Q96GN5|UniProtKB:Q96T49|UniProtKB:Q9BRG1|UniProtKB:Q9H6E4|UniProtKB:Q9NSK0|UniProtKB:Q9NX04|UniProtKB:Q9NY61|UniProtKB:Q9Y4H4 PMID:16189514, PMID:20508642, PMID:20562830, PMID:22644376, PMID:25416956, PMID:25910212, PMID:26871637, PMID:29232376, PMID:32296183, PMID:32911434, PMID:33961781 RGD PMID:16189514|PMID:20508642|PMID:20562830|PMID:22644376|PMID:25416956|PMID:25910212|PMID:26871637|PMID:29232376|PMID:32296183|PMID:32911434|PMID:33961781 Tada2a Rat protein binding enables ISO RGD:1320582,UniProtKB:O75478-2 1624291 UniProtKB:O14964 PMID:26871637 RGD PMID:26871637 Tada2a Rat transcription coactivator activity enables IEA InterPro:IPR016827 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Tada2a Rat transcription coactivator activity enables IBA PANTHER:PTN000271860|SGD:S000002856|TAIR:locus:2130609|UniProtKB:Q75LL6 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Tada2a Rat zinc ion binding enables IEA InterPro:IPR000433 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Tada2a Rat zinc ion binding enables IEA UniProtKB-KW:KW-0863 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Tada2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 69,463,966 - 69,511,612 (-) NCBI GRCr8 mRatBN7.2 10 68,966,502 - 69,014,149 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 68,966,502 - 69,014,105 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 73,586,475 - 73,634,083 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,091,491 - 73,139,094 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 68,555,914 - 68,603,517 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 71,393,701 - 71,441,435 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 71,393,692 - 71,441,389 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 71,307,409 - 71,354,792 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 72,365,950 - 72,413,305 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 72,380,321 - 72,427,675 (-) NCBI Celera 10 67,895,248 - 67,942,367 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
TADA2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 37,406,886 - 37,479,725 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 37,406,886 - 37,479,725 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 35,766,977 - 35,839,830 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 32,841,425 - 32,911,339 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 32,589,436 - 32,660,208 (+) NCBI Celera Cytogenetic Map 17 q12 NCBI HuRef 17 31,705,328 - 31,774,822 (+) NCBI HuRef CHM1_1 17 35,798,449 - 35,868,684 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 38,397,046 - 38,466,403 (+) NCBI T2T-CHM13v2.0
Tada2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 83,969,746 - 84,020,466 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 83,969,746 - 84,020,426 (-) Ensembl GRCm39 Ensembl GRCm38 11 84,078,920 - 84,129,644 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 84,078,920 - 84,129,600 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 83,892,422 - 83,943,070 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 83,895,115 - 83,945,763 (-) NCBI MGSCv36 mm8 Celera 11 93,684,540 - 93,738,158 (-) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 51.29 NCBI
Tada2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 549,028 - 587,996 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 548,373 - 599,739 (-) NCBI ChiLan1.0 ChiLan1.0
TADA2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 27,272,723 - 27,347,127 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 29,156,125 - 29,230,503 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 19,595,055 - 19,670,090 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 19,897,659 - 19,967,926 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 19,897,659 - 19,967,926 (-) Ensembl panpan1.1 panPan2
TADA2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 37,188,193 - 37,241,605 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 37,188,249 - 37,241,512 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 36,412,780 - 36,466,137 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 37,998,547 - 38,052,436 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 37,998,612 - 38,053,162 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 36,779,751 - 36,833,352 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 37,067,593 - 37,120,965 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 37,154,265 - 37,207,674 (+) NCBI UU_Cfam_GSD_1.0
Tada2a
TADA2A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 38,875,250 - 38,928,005 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 38,875,156 - 38,928,011 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 40,496,523 - 40,549,428 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TADA2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 30,303,858 - 30,374,104 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 30,300,532 - 30,374,078 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 1,025,277 - 1,098,948 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tada2a
.
Predicted Target Of
Count of predictions: 317 Count of miRNA genes: 192 Interacting mature miRNAs: 228 Transcripts: ENSRNOT00000003699 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631565 Hcuc4 Hepatic copper content QTL 4 4.15 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 10 66941813 73452992 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1642290 Bp299 Blood pressure QTL 299 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68230134 69282520 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 2289985 Bp305 Blood pressure QTL 305 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 67502108 73579767 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
AU046428
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,031,531 - 142,032,108 (+) MAPPER mRatBN7.2 mRatBN7.2 10 68,982,371 - 68,982,576 (+) MAPPER mRatBN7.2 Rnor_6.0 10 71,409,573 - 71,409,777 NCBI Rnor6.0 Rnor_6.0 5 147,895,949 - 147,896,525 NCBI Rnor6.0 Rnor_5.0 5 151,623,765 - 151,624,341 UniSTS Rnor5.0 Rnor_5.0 10 71,323,281 - 71,323,485 UniSTS Rnor5.0 RGSC_v3.4 10 72,381,818 - 72,382,022 UniSTS RGSC3.4 Celera 10 67,910,754 - 67,910,958 UniSTS Celera 5 140,504,952 - 140,505,528 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 10 q26 UniSTS
RH139765
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 68,966,585 - 68,966,785 (+) MAPPER mRatBN7.2 Rnor_6.0 10 71,393,789 - 71,393,988 NCBI Rnor6.0 Rnor_5.0 10 71,307,497 - 71,307,696 UniSTS Rnor5.0 RGSC_v3.4 10 72,366,034 - 72,366,233 UniSTS RGSC3.4 Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003699 ⟹ ENSRNOP00000003699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 68,966,502 - 69,014,105 (-) Ensembl Rnor_6.0 Ensembl 10 71,393,692 - 71,441,389 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087769 ⟹ ENSRNOP00000071555
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 68,966,502 - 69,014,105 (-) Ensembl Rnor_6.0 Ensembl 10 71,394,313 - 71,439,540 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119062 ⟹ ENSRNOP00000089252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 68,966,504 - 69,007,134 (-) Ensembl
RefSeq Acc Id:
NM_001012141 ⟹ NP_001012141
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,569 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,106 (-) NCBI Rnor_6.0 10 71,393,705 - 71,441,402 (-) NCBI Rnor_5.0 10 71,307,409 - 71,354,792 (-) NCBI RGSC_v3.4 10 72,365,950 - 72,413,305 (-) RGD Celera 10 67,895,248 - 67,942,367 (-) RGD
Sequence:
CGCGCACGCAGAGAGTCTGCACAGCGCACGCAGCGGCGGGCTCTTCGGTGCCGAGGTGCGGGACGTGGCGAGGGGACCGTGGGATTGTTAATCTTTGGCAACTTCTGAAGTCTCAAAGCTCTGTATCA
hide sequence
RefSeq Acc Id:
XM_006247041 ⟹ XP_006247103
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,612 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,149 (-) NCBI Rnor_6.0 10 71,393,701 - 71,441,435 (-) NCBI Rnor_5.0 10 71,307,409 - 71,354,792 (-) NCBI
Sequence:
CACGTGATTCGGGGCCGCGCACGTAGGCCGTGGCGCGCACGCAGAGAGTCTGCACAGCGCACGCAGCGGCGGGCTCTTCGGTGCCGAGGTGCGGGACGTGGCGAGGGGACCGTGGGATTGTTAATCTT
hide sequence
RefSeq Acc Id:
XM_006247042 ⟹ XP_006247104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,591 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,128 (-) NCBI Rnor_6.0 10 71,393,701 - 71,441,428 (-) NCBI Rnor_5.0 10 71,307,409 - 71,354,792 (-) NCBI
Sequence:
TTCGGGGCCGCGCACGTAGGCCGTGGCGCGCACGCAGAGAGTCTGCACAGCGCACGCAGCGGCG
hide sequence
RefSeq Acc Id:
XM_039086362 ⟹ XP_038942290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,551 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,007 (-) NCBI
RefSeq Acc Id:
XM_039086363 ⟹ XP_038942291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,591 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,128 (-) NCBI
RefSeq Acc Id:
XM_039086364 ⟹ XP_038942292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,607 (-) NCBI mRatBN7.2 10 68,966,502 - 69,014,149 (-) NCBI
RefSeq Acc Id:
XM_039086365 ⟹ XP_038942293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,501,601 (-) NCBI mRatBN7.2 10 68,966,502 - 69,004,143 (-) NCBI
RefSeq Acc Id:
XM_063269381 ⟹ XP_063125451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,466,935 - 69,511,612 (-) NCBI
RefSeq Acc Id:
XM_063269382 ⟹ XP_063125452
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 69,463,966 - 69,511,609 (-) NCBI
RefSeq Acc Id:
NP_001012141 ⟸ NM_001012141
- UniProtKB:
A1EC76 (UniProtKB/Swiss-Prot), Q6AYE3 (UniProtKB/Swiss-Prot), A0A8I6ABC7 (UniProtKB/TrEMBL)
- Sequence:
MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTL
hide sequence
RefSeq Acc Id:
XP_006247104 ⟸ XM_006247042
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2UHP0 (UniProtKB/TrEMBL)
- Sequence:
MEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVM
hide sequence
RefSeq Acc Id:
XP_006247103 ⟸ XM_006247041
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K0R7 (UniProtKB/TrEMBL), A0A8I6ABC7 (UniProtKB/TrEMBL)
- Sequence:
MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEAAKTADTAIPFHS
hide sequence
Ensembl Acc Id:
ENSRNOP00000071555 ⟸ ENSRNOT00000087769
Ensembl Acc Id:
ENSRNOP00000003699 ⟸ ENSRNOT00000003699
RefSeq Acc Id:
XP_038942292 ⟸ XM_039086364
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038942291 ⟸ XM_039086363
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2UHP0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942290 ⟸ XM_039086362
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYE3 (UniProtKB/Swiss-Prot), A1EC76 (UniProtKB/Swiss-Prot), A0A8I6ABC7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942293 ⟸ XM_039086365
- Peptide Label:
isoform X8
Ensembl Acc Id:
ENSRNOP00000089252 ⟸ ENSRNOT00000119062
RefSeq Acc Id:
XP_063125452 ⟸ XM_063269382
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063125451 ⟸ XM_063269381
- Peptide Label:
isoform X5
RGD ID: 13697547 Promoter ID: EPDNEW_R8072 Type: initiation region Name: Tada2a_1 Description: transcriptional adaptor 2A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 71,441,384 - 71,441,444 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-01
Tada2a
transcriptional adaptor 2A
Tada2l
transcriptional adaptor 2 (ADA2 homolog, yeast)-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Tada2l
transcriptional adaptor 2 (ADA2 homolog, yeast)-like
Tada2l_predicted
transcriptional adaptor 2 (ADA2 homolog, yeast)-like (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tada2l_predicted
transcriptional adaptor 2 (ADA2 homolog, yeast)-like (predicted)
Symbol and Name status set to approved
70820 APPROVED
