Symbol:
Fgd2
Name:
FYVE, RhoGEF and PH domain containing 2
RGD ID:
1309840
Description:
Predicted to enable guanyl-nucleotide exchange factor activity and phosphatidylinositol phosphate binding activity. Predicted to be involved in cytoskeleton organization and filopodium assembly. Predicted to act upstream of or within positive regulation of JUN kinase activity. Predicted to be located in early endosome; nucleus; and ruffle. Predicted to be active in cytoplasm. Orthologous to human FGD2 (FYVE, RhoGEF and PH domain containing 2); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
FYVE, RhoGEF and PH domain-containing protein 2; LOC309653
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FGD2 (FYVE, RhoGEF and PH domain containing 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fgd2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fgd2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FGD2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FGD2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fgd2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FGD2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FGD2 (FYVE, RhoGEF and PH domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FGD4 (FYVE, RhoGEF and PH domain containing 4) HGNC
OrthoDB
Homo sapiens (human):
FGD6 (FYVE, RhoGEF and PH domain containing 6) HGNC
Treefam
Alliance orthologs 3
Homo sapiens (human):
FGD2 (FYVE, RhoGEF and PH domain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fgd2 (FYVE, RhoGEF and PH domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
exc-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 7,426,407 - 7,443,207 (+) NCBI GRCr8 mRatBN7.2 20 7,424,795 - 7,441,603 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 7,424,790 - 7,441,603 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 8,127,837 - 8,144,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 7,489,694 - 7,506,838 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,961,599 - 7,978,728 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,973,356 - 6,990,026 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,973,398 - 6,990,023 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 9,212,072 - 9,228,719 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,684,764 - 7,702,116 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,685,169 - 7,701,720 (+) NCBI Celera 20 8,967,909 - 8,984,674 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fgd2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FGD2 mRNA] CTD PMID:31150632 Fgd2 Rat 1,2-dimethylhydrazine increases expression ISO Fgd2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FGD2 mRNA CTD PMID:22206623 Fgd2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FGD2 mRNA CTD PMID:32741896 Fgd2 Rat 17beta-estradiol decreases expression ISO Fgd2 (Mus musculus) 6480464 Estradiol results in decreased expression of FGD2 mRNA CTD PMID:39298647 Fgd2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FGD2 mRNA CTD PMID:32741896 Fgd2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fgd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGD2 mRNA CTD PMID:15652763 Fgd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FGD2 mRNA CTD PMID:34747641 Fgd2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fgd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FGD2 mRNA CTD PMID:21570461 more ... Fgd2 Rat 2-palmitoylglycerol increases expression ISO FGD2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of FGD2 mRNA CTD PMID:37199045 Fgd2 Rat 4,4'-sulfonyldiphenol increases expression ISO Fgd2 (Mus musculus) 6480464 bisphenol S results in increased expression of FGD2 mRNA CTD PMID:30951980 Fgd2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Fgd2 (Mus musculus) 6480464 bisphenol S results in decreased expression of FGD2 mRNA CTD PMID:39298647 Fgd2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FGD2 mRNA CTD PMID:31881176 Fgd2 Rat all-trans-retinoic acid decreases expression ISO FGD2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of FGD2 mRNA CTD PMID:23724009 Fgd2 Rat all-trans-retinoic acid increases expression ISO FGD2 (Homo sapiens) 6480464 Tretinoin results in increased expression of FGD2 mRNA CTD PMID:33167477 Fgd2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of FGD2 mRNA CTD PMID:35163327 Fgd2 Rat antirheumatic drug decreases expression ISO FGD2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of FGD2 mRNA CTD PMID:24449571 Fgd2 Rat arsane multiple interactions ISO FGD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of FGD2 mRNA CTD PMID:32525701 Fgd2 Rat arsenic atom multiple interactions ISO FGD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of FGD2 mRNA CTD PMID:32525701 Fgd2 Rat benzo[a]pyrene affects methylation ISO FGD2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FGD2 5' UTR and Benzo(a)pyrene affects the methylation of FGD2 promoter CTD PMID:27901495 Fgd2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FGD2 mRNA CTD PMID:25181051 Fgd2 Rat bisphenol A increases expression ISO Fgd2 (Mus musculus) 6480464 bisphenol A results in increased expression of FGD2 mRNA CTD PMID:32156529 Fgd2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FGD2 gene CTD PMID:28505145 Fgd2 Rat bisphenol F increases expression ISO Fgd2 (Mus musculus) 6480464 bisphenol F results in increased expression of FGD2 mRNA CTD PMID:30951980 Fgd2 Rat bisphenol F decreases expression ISO Fgd2 (Mus musculus) 6480464 bisphenol F results in decreased expression of FGD2 mRNA CTD PMID:38685157 Fgd2 Rat buta-1,3-diene decreases expression ISO Fgd2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of FGD2 mRNA CTD PMID:29038090 Fgd2 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of FGD2 mRNA CTD PMID:19167457 Fgd2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of FGD2 promoter CTD PMID:22457795 Fgd2 Rat carbon nanotube increases expression ISO Fgd2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of FGD2 protein CTD PMID:34864091 Fgd2 Rat CGP 52608 multiple interactions ISO FGD2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FGD2 gene] CTD PMID:28238834 Fgd2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FGD2 mRNA CTD PMID:27523638 Fgd2 Rat dioxygen multiple interactions ISO Fgd2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FGD2 mRNA CTD PMID:30529165 Fgd2 Rat ethanol increases expression ISO Fgd2 (Mus musculus) 6480464 Ethanol results in increased expression of FGD2 mRNA CTD PMID:30319688 Fgd2 Rat folic acid decreases expression ISO Fgd2 (Mus musculus) 6480464 Folic Acid results in decreased expression of FGD2 mRNA CTD PMID:25629700 Fgd2 Rat fragrance increases expression ISO FGD2 (Homo sapiens) 6480464 Perfume results in increased expression of FGD2 mRNA CTD PMID:24768652 Fgd2 Rat furan increases expression EXP 6480464 furan results in increased expression of FGD2 mRNA CTD PMID:27387713 Fgd2 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of FGD2 mRNA CTD PMID:35283115 Fgd2 Rat lipopolysaccharide multiple interactions ISO FGD2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGD2 mRNA CTD PMID:35811015 Fgd2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FGD2 gene CTD PMID:35440735 Fgd2 Rat nickel atom increases expression ISO FGD2 (Homo sapiens) 6480464 Nickel results in increased expression of FGD2 mRNA CTD PMID:24768652 and PMID:25583101 Fgd2 Rat nitrates multiple interactions ISO Fgd2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of FGD2 mRNA CTD PMID:35964746 Fgd2 Rat ozone multiple interactions ISO Fgd2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of FGD2 mRNA CTD PMID:34911549 Fgd2 Rat permethrin increases expression ISO FGD2 (Homo sapiens) 6480464 Permethrin results in increased expression of FGD2 mRNA CTD PMID:37047231 Fgd2 Rat pravastatin decreases expression ISO Fgd2 (Mus musculus) 6480464 Pravastatin results in decreased expression of FGD2 mRNA CTD PMID:27225895 Fgd2 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of FGD2 mRNA CTD PMID:27225895 Fgd2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO FGD2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGD2 mRNA CTD PMID:35811015 Fgd2 Rat silicon dioxide decreases expression ISO Fgd2 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of FGD2 mRNA CTD PMID:29203145 Fgd2 Rat sodium arsenate multiple interactions ISO FGD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of FGD2 mRNA CTD PMID:32525701 Fgd2 Rat sodium arsenite decreases expression ISO Fgd2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FGD2 mRNA CTD PMID:37682722 Fgd2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of FGD2 mRNA CTD PMID:19281266 Fgd2 Rat succimer multiple interactions ISO Fgd2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of FGD2 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of FGD2 mRNA CTD PMID:21641980 and PMID:26378955 Fgd2 Rat succimer multiple interactions ISO FGD2 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of FGD2 mRNA CTD PMID:26378955 Fgd2 Rat tacrolimus hydrate increases expression ISO Fgd2 (Mus musculus) 6480464 Tacrolimus results in increased expression of FGD2 mRNA CTD PMID:29362864 Fgd2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FGD2 mRNA CTD PMID:32741896 Fgd2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FGD2 mRNA CTD PMID:31150632 Fgd2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FGD2 mRNA] CTD PMID:31150632 Fgd2 Rat Theaflavin 3,3'-digallate affects expression ISO FGD2 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of FGD2 mRNA CTD PMID:34925699 Fgd2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FGD2 mRNA CTD PMID:34492290 Fgd2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of FGD2 mRNA CTD PMID:33387578 Fgd2 Rat triptonide increases expression ISO Fgd2 (Mus musculus) 6480464 triptonide results in increased expression of FGD2 mRNA CTD PMID:33045310 Fgd2 Rat tungsten decreases expression ISO Fgd2 (Mus musculus) 6480464 Tungsten results in decreased expression of FGD2 mRNA CTD PMID:30912803
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) Cuprizon (EXP) dioxygen (ISO) ethanol (ISO) folic acid (ISO) fragrance (ISO) furan (EXP) lidocaine (EXP) lipopolysaccharide (ISO) methoxychlor (EXP) nickel atom (ISO) nitrates (ISO) ozone (ISO) permethrin (ISO) pravastatin (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) tacrolimus hydrate (ISO) testosterone (EXP) tetrachloromethane (EXP) Theaflavin 3,3'-digallate (ISO) thioacetamide (EXP) trichloroethene (EXP) triptonide (ISO) tungsten (ISO)
Fgd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 7,426,407 - 7,443,207 (+) NCBI GRCr8 mRatBN7.2 20 7,424,795 - 7,441,603 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 7,424,790 - 7,441,603 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 8,127,837 - 8,144,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 7,489,694 - 7,506,838 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,961,599 - 7,978,728 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,973,356 - 6,990,026 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,973,398 - 6,990,023 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 9,212,072 - 9,228,719 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,684,764 - 7,702,116 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,685,169 - 7,701,720 (+) NCBI Celera 20 8,967,909 - 8,984,674 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
FGD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 37,005,655 - 37,029,069 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 37,005,646 - 37,029,299 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 36,973,431 - 36,996,845 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 37,081,401 - 37,104,822 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 37,081,400 - 37,104,822 NCBI Celera 6 38,528,396 - 38,551,886 (+) NCBI Celera Cytogenetic Map 6 p21.2 NCBI HuRef 6 36,691,770 - 36,715,184 (+) NCBI HuRef CHM1_1 6 36,975,223 - 36,998,669 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 36,829,039 - 36,852,622 (+) NCBI T2T-CHM13v2.0
Fgd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 29,579,878 - 29,598,509 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 29,579,888 - 29,598,635 (+) Ensembl GRCm39 Ensembl GRCm38 17 29,360,904 - 29,379,535 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 29,360,914 - 29,379,661 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 29,497,859 - 29,516,480 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 29,087,926 - 29,106,565 (+) NCBI MGSCv36 mm8 Celera 17 29,903,505 - 29,922,630 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 15.26 NCBI
Fgd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 6,024,301 - 6,038,349 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 6,026,087 - 6,038,740 (-) NCBI ChiLan1.0 ChiLan1.0
FGD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 51,473,851 - 51,497,972 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 47,343,620 - 47,374,549 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 36,566,942 - 36,591,044 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 37,762,646 - 37,787,186 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 37,762,809 - 37,785,291 (+) Ensembl panpan1.1 panPan2
FGD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 6,069,251 - 6,091,972 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 6,068,910 - 6,139,707 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 6,087,785 - 6,110,527 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 6,418,188 - 6,440,928 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 6,417,971 - 6,440,890 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 6,072,861 - 6,095,355 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 6,152,181 - 6,174,920 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 6,250,596 - 6,273,316 (+) NCBI UU_Cfam_GSD_1.0
Fgd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 41,513,954 - 41,536,375 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 22,424,042 - 22,442,689 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 22,423,851 - 22,442,795 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FGD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 32,648,222 - 32,674,529 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 32,648,260 - 32,674,539 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 37,551,703 - 37,577,990 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FGD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 35,112,453 - 35,136,161 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 35,112,815 - 35,136,017 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 36,943,781 - 36,967,321 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 260 Count of miRNA genes: 176 Interacting mature miRNAs: 197 Transcripts: ENSRNOT00000041665 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
AI411563
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 7,441,319 - 7,441,409 (+) MAPPER mRatBN7.2 Rnor_6.0 20 6,989,740 - 6,989,829 NCBI Rnor6.0 Rnor_5.0 20 9,228,433 - 9,228,522 UniSTS Rnor5.0 RGSC_v3.4 20 7,701,833 - 7,701,922 UniSTS RGSC3.4 Celera 20 8,984,391 - 8,984,480 UniSTS RH 3.4 Map 20 78.24 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041665 ⟹ ENSRNOP00000039744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 7,424,790 - 7,441,603 (+) Ensembl Rnor_6.0 Ensembl 20 6,973,398 - 6,990,023 (+) Ensembl
RefSeq Acc Id:
NM_001107617 ⟹ NP_001101087
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,414 - 7,443,207 (+) NCBI mRatBN7.2 20 7,424,801 - 7,441,603 (+) NCBI Rnor_6.0 20 6,973,398 - 6,990,023 (+) NCBI Rnor_5.0 20 9,212,072 - 9,228,719 (+) NCBI RGSC_v3.4 20 7,684,764 - 7,702,116 (+) RGD Celera 20 8,967,909 - 8,984,674 (+) RGD
Sequence:
CACTTCCTCTTTTATCGCTCTGAAGATAGGAACTGCCCCAGGGCAGTCAGAAGAGATGGGCAGATTCCAGGCTGTGGTAGCCCTGCTTCCCGCGCAGGCCAGGGAGTGCTGAGGGCGCTGACCGCTTG
hide sequence
RefSeq Acc Id:
XM_006256205 ⟹ XP_006256267
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,412 - 7,443,207 (+) NCBI mRatBN7.2 20 7,424,799 - 7,441,552 (+) NCBI Rnor_6.0 20 6,973,357 - 6,990,026 (+) NCBI Rnor_5.0 20 9,212,072 - 9,228,719 (+) NCBI
Sequence:
CACAGTAGGGAGCGCTGGTCTCTCTTCCAAGTCACTGGGACCACTTCCTCTTTTATCGCTCTGAAGATAGGAACTGCCCCAGGGCAGTCAGAAGAGATGGGCAGATTCCAGGCTGTGGTAGCCCTGCT
hide sequence
RefSeq Acc Id:
XM_017601651 ⟹ XP_017457140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,432,190 - 7,443,207 (+) NCBI mRatBN7.2 20 7,430,582 - 7,441,552 (+) NCBI Rnor_6.0 20 6,979,232 - 6,990,026 (+) NCBI
Sequence:
GAACTTTGAGCGGGCGGCAGAACTGCTGGCCACCTGGATGGACAAGTCACAGCCCTTCCAGGAG
hide sequence
RefSeq Acc Id:
XM_039098711 ⟹ XP_038954639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,411 - 7,443,207 (+) NCBI mRatBN7.2 20 7,424,799 - 7,441,552 (+) NCBI
RefSeq Acc Id:
XM_039098712 ⟹ XP_038954640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,411 - 7,443,207 (+) NCBI mRatBN7.2 20 7,424,799 - 7,441,552 (+) NCBI
RefSeq Acc Id:
XM_039098713 ⟹ XP_038954641
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,410 - 7,441,773 (+) NCBI mRatBN7.2 20 7,424,798 - 7,440,221 (+) NCBI
RefSeq Acc Id:
XM_039098714 ⟹ XP_038954642
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,408 - 7,438,077 (+) NCBI mRatBN7.2 20 7,424,796 - 7,436,470 (+) NCBI
RefSeq Acc Id:
XM_039098715 ⟹ XP_038954643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,407 - 7,433,486 (+) NCBI mRatBN7.2 20 7,424,795 - 7,431,876 (+) NCBI
RefSeq Acc Id:
XM_063279150 ⟹ XP_063135220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,411 - 7,443,207 (+) NCBI
RefSeq Acc Id:
XM_063279151 ⟹ XP_063135221
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,407 - 7,437,288 (+) NCBI
RefSeq Acc Id:
XM_063279152 ⟹ XP_063135222
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,411 - 7,437,285 (+) NCBI
RefSeq Acc Id:
XM_063279153 ⟹ XP_063135223
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,426,411 - 7,443,207 (+) NCBI
RefSeq Acc Id:
NP_001101087 ⟸ NM_001107617
- UniProtKB:
D3Z9I3 (UniProtKB/TrEMBL)
- Sequence:
MEQACAKQDSVCNLVAVFENSRSPGAAPGPHSFEDQPHSPEHQLPLSPEPWEAPPAGEALTSEFRPVSRTYLNSLKNKLSSGAWRKSCQPGASPGPETQEPEEKRVVQELLETEQAYVARLHLLDQVF
hide sequence
RefSeq Acc Id:
XP_006256267 ⟸ XM_006256205
- Peptide Label:
isoform X4
- UniProtKB:
D3Z9I3 (UniProtKB/TrEMBL)
- Sequence:
MEQACAKQDSVCNLVAVFENSSRSPGAAPGPHSFEDQPHSPEHQLPLSPEPWEAPPAGEALTSE
hide sequence
RefSeq Acc Id:
XP_017457140 ⟸ XM_017601651
- Peptide Label:
isoform X9
- UniProtKB:
A6JJU9 (UniProtKB/TrEMBL)
- Sequence:
MLEPVQRIPRYELLLKEYVQKLPAQAPDLEDAQRALDMIFSAAQHSNAAIAEMERLQGLWDVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRID
hide sequence
Ensembl Acc Id:
ENSRNOP00000039744 ⟸ ENSRNOT00000041665
RefSeq Acc Id:
XP_038954643 ⟸ XM_039098715
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_038954642 ⟸ XM_039098714
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038954641 ⟸ XM_039098713
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038954639 ⟸ XM_039098711
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038954640 ⟸ XM_039098712
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063135221 ⟸ XM_063279151
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063135220 ⟸ XM_063279150
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063135223 ⟸ XM_063279153
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063135222 ⟸ XM_063279152
- Peptide Label:
isoform X8
RGD ID: 13701446 Promoter ID: EPDNEW_R11970 Type: initiation region Name: Fgd2_1 Description: FYVE, RhoGEF and PH domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 6,973,399 - 6,973,459 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Fgd2
FYVE, RhoGEF and PH domain containing 2
Fgd2_predicted
FYVE, RhoGEF and PH domain containing 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Fgd2_predicted
FYVE, RhoGEF and PH domain containing 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
