Symbol:
Tubb2b
Name:
tubulin, beta 2B class IIb
RGD ID:
1309427
Description:
Predicted to enable GTP binding activity and protein heterodimerization activity. Predicted to be a structural constituent of cytoskeleton. Involved in neuron migration. Predicted to be located in intercellular bridge and mitotic spindle. Predicted to be active in Schaffer collateral - CA1 synapse; cytoplasm; and microtubule. Human ortholog(s) of this gene implicated in complex cortical dysplasia with other brain malformations 7. Orthologous to human TUBB2B (tubulin beta 2B class IIb); PARTICIPATES IN phagocytosis pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
beta-tubulin T beta15 (aa 1-445); LOC291081; MGC124866; RGD1309427; similar to tubulin, beta; t beta-15; Tubb2; tubulin beta-2B chain; tubulin, beta 2; tubulin, beta 2B; tubulin, beta-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TUBB2B (tubulin beta 2B class IIb) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tubb2b (tubulin, beta 2B class IIB) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC478702 (tubulin beta-2B chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100624785 (tubulin beta-2A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TUBB6 (tubulin beta 6 class V) HGNC
OrthoDB
Homo sapiens (human):
TUBB3 (tubulin beta 3 class III) HGNC
OrthoDB
Homo sapiens (human):
TUBB2A (tubulin beta 2A class IIa) HGNC
OrthoDB
Homo sapiens (human):
TUBB4A (tubulin beta 4A class IVa) HGNC
OrthoDB
Homo sapiens (human):
TUBB4B (tubulin beta 4B class IVb) HGNC
OrthoDB
Homo sapiens (human):
HORMAD2 (HORMA domain containing 2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Tubb2b (tubulin, beta 2B class IIB)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TUBB2B (tubulin beta 2B class IIb)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tubb2 (tubulin, beta 2A class IIa)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
TUB2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
betaTub56D
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
tbb-4
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tubb2b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 30,953,086 - 30,956,133 (+) NCBI GRCr8 mRatBN7.2 17 30,747,734 - 30,750,781 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,747,734 - 30,750,638 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,560,900 - 30,563,955 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,164,652 - 32,167,707 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,556,638 - 30,559,693 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 31,441,640 - 31,444,687 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 31,441,630 - 31,482,759 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 33,336,065 - 33,339,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,087,922 - 37,090,969 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,142,086 - 37,145,700 (+) NCBI Celera 17 30,312,117 - 30,315,164 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tubb2b Rat (+)-catechin multiple interactions ISO RGD:1602407 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of TUBB2B mRNA CTD PMID:24763279 Tubb2b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:1319765 6480464 o,p'-DDT results in increased expression of TUBB2B mRNA CTD PMID:24096037 Tubb2b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o,p'-DDT results in increased expression of TUBB2B mRNA CTD PMID:24096037 Tubb2b Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1319765 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of TUBB2B mRNA] CTD PMID:22206623 Tubb2b Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1319765 6480464 1,2-Dimethylhydrazine results in decreased expression of TUBB2B mRNA CTD PMID:22206623 Tubb2b Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of TUBB2B mRNA CTD PMID:12832660 Tubb2b Rat 17alpha-ethynylestradiol increases expression ISO RGD:1319765 6480464 Ethinyl Estradiol results in increased expression of TUBB2B mRNA CTD PMID:24096037 Tubb2b Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TUBB2B mRNA CTD PMID:24096037 Tubb2b Rat 17beta-estradiol multiple interactions ISO RGD:1602407 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TUBB2B mRNA CTD PMID:20660070 Tubb2b Rat 17beta-estradiol increases expression ISO RGD:1602407 6480464 Estradiol results in increased expression of TUBB2B mRNA CTD PMID:31614463 Tubb2b Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TUBB2B mRNA CTD PMID:32145629 Tubb2b Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TUBB2B mRNA CTD PMID:32741896 Tubb2b Rat 17beta-estradiol 3-benzoate decreases methylation EXP 6480464 estradiol 3-benzoate results in decreased methylation of TUBB2B promoter CTD PMID:27415467 Tubb2b Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TUBB2B mRNA CTD PMID:32741896 Tubb2b Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO RGD:1319765 6480464 2,3',4,4',5-pentachlorobiphenyl affects the expression of TUBB2B mRNA CTD PMID:31388691 Tubb2b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1319765 6480464 Tetrachlorodibenzodioxin results in increased expression of TUBB2B mRNA CTD PMID:19770486|PMID:33956508 Tubb2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TUBB2B mRNA CTD PMID:32109520 Tubb2b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1319765 6480464 Tetrachlorodibenzodioxin affects the expression of TUBB2B mRNA CTD PMID:21570461 Tubb2b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1602407 6480464 Tetrachlorodibenzodioxin results in increased expression of TUBB2B mRNA CTD PMID:21632981 Tubb2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1319765 6480464 Tetrachlorodibenzodioxin results in decreased expression of TUBB2B mRNA CTD PMID:21041162 Tubb2b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of TUBB2B mRNA CTD PMID:32109520 Tubb2b Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1319765 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of TUBB2B mRNA CTD PMID:38648751 Tubb2b Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of TUBB2B mRNA CTD PMID:21346803 Tubb2b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of TUBB2B mRNA CTD PMID:21346803 Tubb2b Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO RGD:1602407 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in decreased expression of TUBB2B protein CTD PMID:32044396 Tubb2b Rat 2-amino-4,6-dinitrotoluene affects expression EXP 6480464 2-amino-4,6-dinitrotoluene affects the expression of TUBB2B mRNA CTD PMID:21346803 Tubb2b Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of TUBB2B protein CTD PMID:15928459 Tubb2b Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of TUBB2B mRNA CTD PMID:32119087 Tubb2b Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1319765 6480464 Fenretinide results in increased expression of TUBB2B mRNA CTD PMID:28973697 Tubb2b Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:1602407 6480464 Decitabine results in increased expression of TUBB2B mRNA CTD PMID:21856257 Tubb2b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TUBB2B mRNA CTD PMID:24780913|PMID:36843608 Tubb2b Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of TUBB2B mRNA CTD PMID:12376462 Tubb2b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TUBB2B mRNA CTD PMID:31881176 Tubb2b Rat acrolein multiple interactions ISO RGD:1602407 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of TUBB2B mRNA CTD PMID:32845096 Tubb2b Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TUBB2B mRNA CTD PMID:28959563 Tubb2b Rat acrylamide decreases expression ISO RGD:1602407 6480464 Acrylamide results in decreased expression of TUBB2B mRNA CTD PMID:32763439 Tubb2b Rat acrylamide decreases expression ISO RGD:1319765 6480464 Acrylamide results in decreased expression of TUBB2B mRNA CTD PMID:30807115 Tubb2b Rat actinomycin D multiple interactions ISO RGD:1602407 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of TUBB2B protein CTD PMID:38460933 Tubb2b Rat all-trans-retinoic acid increases expression ISO RGD:1602407 6480464 Tretinoin results in increased expression of TUBB2B mRNA CTD PMID:15498508 Tubb2b Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of TUBB2B mRNA CTD PMID:20488242 Tubb2b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TUBB2B mRNA CTD PMID:16483693 Tubb2b Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TUBB2B mRNA CTD PMID:30779732 Tubb2b Rat antimycin A decreases expression ISO RGD:1602407 6480464 Antimycin A results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat arsane decreases expression ISO RGD:1602407 6480464 Arsenic results in decreased expression of TUBB2B protein CTD PMID:19818359 Tubb2b Rat arsane multiple interactions ISO RGD:1602407 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TUBB2B more ... CTD PMID:39836092 Tubb2b Rat arsenic atom decreases expression ISO RGD:1602407 6480464 Arsenic results in decreased expression of TUBB2B protein CTD PMID:19818359 Tubb2b Rat arsenic atom multiple interactions ISO RGD:1602407 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TUBB2B more ... CTD PMID:39836092 Tubb2b Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TUBB2B mRNA CTD PMID:36841081 Tubb2b Rat azoxystrobin decreases expression ISO RGD:1602407 6480464 azoxystrobin results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat benzo[a]pyrene decreases expression ISO RGD:1319765 6480464 Benzo(a)pyrene results in decreased expression of TUBB2B mRNA CTD PMID:19770486 Tubb2b Rat benzo[a]pyrene increases methylation ISO RGD:1602407 6480464 Benzo(a)pyrene results in increased methylation of TUBB2B exon CTD PMID:27901495 Tubb2b Rat benzo[a]pyrene decreases methylation ISO RGD:1602407 6480464 Benzo(a)pyrene results in decreased methylation of TUBB2B 3' UTR CTD PMID:27901495 Tubb2b Rat benzo[a]pyrene affects methylation ISO RGD:1602407 6480464 Benzo(a)pyrene affects the methylation of TUBB2B promoter CTD PMID:27901495 Tubb2b Rat benzo[a]pyrene increases expression ISO RGD:1319765 6480464 Benzo(a)pyrene results in increased expression of TUBB2B mRNA CTD PMID:22228805 Tubb2b Rat benzo[a]pyrene multiple interactions ISO RGD:1319765 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TUBB2B mRNA] CTD PMID:22228805 Tubb2b Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TUBB2B mRNA CTD PMID:21839799 Tubb2b Rat benzo[b]fluoranthene increases expression ISO RGD:1319765 6480464 benzo(b)fluoranthene results in increased expression of TUBB2B mRNA CTD PMID:26377693 Tubb2b Rat beta-lapachone increases expression ISO RGD:1602407 6480464 beta-lapachone results in increased expression of TUBB2B mRNA CTD PMID:38218311 Tubb2b Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of TUBB2B mRNA CTD PMID:20920545 Tubb2b Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1319765 6480464 Diethylhexyl Phthalate results in increased expression of TUBB2B mRNA CTD PMID:33754040 Tubb2b Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TUBB2B mRNA CTD PMID:25181051 Tubb2b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TUBB2B mRNA CTD PMID:38750585 Tubb2b Rat bisphenol A decreases expression ISO RGD:1319765 6480464 bisphenol A results in decreased expression of TUBB2B mRNA CTD PMID:32156529 Tubb2b Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of TUBB2B mRNA CTD PMID:15056800 Tubb2b Rat butanal increases expression ISO RGD:1602407 6480464 butyraldehyde results in increased expression of TUBB2B mRNA CTD PMID:26079696 Tubb2b Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat cadmium atom multiple interactions ISO RGD:1602407 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TUBB2B more ... CTD PMID:35301059 Tubb2b Rat cadmium dichloride multiple interactions ISO RGD:1602407 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TUBB2B more ... CTD PMID:35301059 Tubb2b Rat cannabidiol multiple interactions ISO RGD:1319765 6480464 Cannabidiol inhibits the reaction [MOG protein modified form results in increased expression of TUBB2B mRNA] CTD PMID:27256343 Tubb2b Rat carbon nanotube affects expression ISO RGD:1319765 6480464 Nanotubes, Carbon affects the expression of TUBB2B mRNA CTD PMID:25554681 Tubb2b Rat carbon nanotube increases expression ISO RGD:1319765 6480464 Nanotubes, Carbon analog results in increased expression of TUBB2B mRNA CTD PMID:25554681 Tubb2b Rat chloroprene decreases expression ISO RGD:1319765 6480464 Chloroprene results in decreased expression of TUBB2B mRNA CTD PMID:23125180 Tubb2b Rat chlorpyrifos decreases expression ISO RGD:1319765 6480464 Chlorpyrifos results in decreased expression of TUBB2B mRNA CTD PMID:37019170 Tubb2b Rat cisplatin decreases expression ISO RGD:1602407 6480464 Cisplatin results in decreased expression of TUBB2B mRNA CTD PMID:27392435 Tubb2b Rat cisplatin multiple interactions ISO RGD:1602407 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of TUBB2B mRNA]; jinfukang promotes the more ... CTD PMID:27392435 Tubb2b Rat copper atom multiple interactions ISO RGD:1602407 6480464 [Disulfiram binds to Copper] which results in decreased expression of TUBB2B mRNA CTD PMID:24690739 Tubb2b Rat copper(0) multiple interactions ISO RGD:1602407 6480464 [Disulfiram binds to Copper] which results in decreased expression of TUBB2B mRNA CTD PMID:24690739 Tubb2b Rat CU-O LINKAGE decreases expression ISO RGD:1602407 6480464 cupric oxide results in decreased expression of TUBB2B mRNA CTD PMID:22077320 Tubb2b Rat cyclophosphamide decreases expression ISO RGD:1319765 6480464 Cyclophosphamide results in decreased expression of TUBB2B mRNA CTD PMID:21041162 Tubb2b Rat cyclosporin A affects expression ISO RGD:1602407 6480464 Cyclosporine affects the expression of TUBB2B mRNA CTD PMID:20106945 Tubb2b Rat cyclosporin A decreases methylation ISO RGD:1602407 6480464 Cyclosporine results in decreased methylation of TUBB2B promoter CTD PMID:27989131 Tubb2b Rat cyclosporin A increases expression ISO RGD:1602407 6480464 Cyclosporine results in increased expression of TUBB2B mRNA CTD PMID:21632981|PMID:25562108 Tubb2b Rat dexamethasone decreases expression ISO RGD:1319765 6480464 Dexamethasone results in decreased expression of TUBB2B mRNA CTD PMID:21041162 Tubb2b Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TUBB2B mRNA CTD PMID:21266533 Tubb2b Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat diethylstilbestrol decreases expression ISO RGD:1319765 6480464 Diethylstilbestrol results in decreased expression of TUBB2B mRNA CTD PMID:21041162 Tubb2b Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Tubb2b Rat disulfiram multiple interactions ISO RGD:1602407 6480464 [Disulfiram binds to Copper] which results in decreased expression of TUBB2B mRNA CTD PMID:24690739 Tubb2b Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of TUBB2B mRNA CTD PMID:17920746 Tubb2b Rat ethanol increases expression ISO RGD:1319765 6480464 Ethanol results in increased expression of TUBB2B mRNA CTD PMID:30319688 Tubb2b Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TUBB2B protein CTD PMID:23702218 Tubb2b Rat fenpyroximate decreases expression ISO RGD:1602407 6480464 fenpyroximate results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat ferric oxide increases expression ISO RGD:1319765 6480464 ferric oxide analog results in increased expression of TUBB2B mRNA CTD PMID:24525745 Tubb2b Rat folic acid decreases expression ISO RGD:1319765 6480464 Folic Acid results in decreased expression of TUBB2B mRNA CTD PMID:25629700 Tubb2b Rat folic acid multiple interactions ISO RGD:1319765 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of TUBB2B mRNA] CTD PMID:22206623 Tubb2b Rat furan increases expression EXP 6480464 furan results in increased expression of TUBB2B mRNA CTD PMID:27387713 Tubb2b Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of TUBB2B gene CTD PMID:27387713 Tubb2b Rat genistein increases expression ISO RGD:1602407 6480464 Genistein results in increased expression of TUBB2B mRNA CTD PMID:26865667 Tubb2b Rat ivermectin decreases expression ISO RGD:1602407 6480464 Ivermectin results in decreased expression of TUBB2B protein CTD PMID:32959892 Tubb2b Rat leflunomide decreases expression ISO RGD:1319765 6480464 leflunomide results in decreased expression of TUBB2B mRNA CTD PMID:19751817 Tubb2b Rat lipopolysaccharide multiple interactions ISO RGD:1602407 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of TUBB2B mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ... CTD PMID:35811015 Tubb2b Rat lipopolysaccharide increases expression ISO RGD:1602407 6480464 Lipopolysaccharides results in increased expression of TUBB2B mRNA CTD PMID:35811015 Tubb2b Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of TUBB2B protein CTD PMID:22430071 Tubb2b Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of TUBB2B protein CTD PMID:19716841 Tubb2b Rat nitrates multiple interactions ISO RGD:1319765 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TUBB2B more ... CTD PMID:35964746 Tubb2b Rat Nutlin-3 multiple interactions ISO RGD:1602407 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of TUBB2B protein CTD PMID:38460933 Tubb2b Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TUBB2B mRNA CTD PMID:25729387 Tubb2b Rat ozone multiple interactions ISO RGD:1602407 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of TUBB2B mRNA CTD PMID:32845096 Tubb2b Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TUBB2B mRNA CTD PMID:33387578 Tubb2b Rat pentanal increases expression ISO RGD:1602407 6480464 pentanal results in increased expression of TUBB2B mRNA CTD PMID:26079696 Tubb2b Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of TUBB2B mRNA CTD PMID:12376462 Tubb2b Rat picoxystrobin decreases expression ISO RGD:1602407 6480464 picoxystrobin results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat pirinixic acid increases expression ISO RGD:1319765 6480464 pirinixic acid results in increased expression of TUBB2B mRNA CTD PMID:20813756 Tubb2b Rat progesterone multiple interactions ISO RGD:1602407 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TUBB2B mRNA CTD PMID:20660070 Tubb2b Rat pyrimidifen decreases expression ISO RGD:1602407 6480464 pyrimidifen results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat quercetin increases expression ISO RGD:1602407 6480464 Quercetin results in increased expression of TUBB2B mRNA CTD PMID:21632981 Tubb2b Rat rotenone affects expression ISO RGD:1319765 6480464 Rotenone affects the expression of TUBB2B mRNA CTD PMID:21893155 Tubb2b Rat rotenone affects expression ISO RGD:1602407 6480464 Rotenone affects the expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat rotenone multiple interactions ISO RGD:1319765 6480464 TRP53 affects the reaction [Rotenone affects the expression of TUBB2B mRNA] CTD PMID:21893155 Tubb2b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1602407 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of TUBB2B mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ... CTD PMID:35811015 Tubb2b Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of TUBB2B protein CTD PMID:28973502 Tubb2b Rat SB 431542 multiple interactions ISO RGD:1602407 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of TUBB2B more ... CTD PMID:37664457 Tubb2b Rat silicon dioxide affects expression ISO RGD:1602407 6480464 Silicon Dioxide analog affects the expression of TUBB2B mRNA CTD PMID:23806026 Tubb2b Rat sodium arsenite increases expression ISO RGD:1602407 6480464 sodium arsenite results in increased expression of TUBB2B mRNA CTD PMID:38568856 Tubb2b Rat sodium arsenite multiple interactions ISO RGD:1602407 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TUBB2B more ... CTD PMID:39836092 Tubb2b Rat sodium fluoride increases expression ISO RGD:1319765 6480464 Sodium Fluoride results in increased expression of TUBB2B protein CTD PMID:27548804 Tubb2b Rat Soman increases expression EXP 6480464 Soman results in increased expression of TUBB2B mRNA CTD PMID:19281266 Tubb2b Rat sunitinib increases expression ISO RGD:1602407 6480464 Sunitinib results in increased expression of TUBB2B mRNA CTD PMID:31533062 Tubb2b Rat tamibarotene increases expression ISO RGD:1602407 6480464 tamibarotene results in increased expression of TUBB2B mRNA CTD PMID:15498508 Tubb2b Rat tamoxifen increases expression ISO RGD:1319765 6480464 Tamoxifen results in increased expression of TUBB2B mRNA CTD PMID:25123088 Tubb2b Rat tebufenpyrad decreases expression ISO RGD:1602407 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat temozolomide increases expression ISO RGD:1602407 6480464 Temozolomide results in increased expression of TUBB2B mRNA CTD PMID:31758290 Tubb2b Rat tert-butyl hydroperoxide decreases expression ISO RGD:1602407 6480464 tert-Butylhydroperoxide results in decreased expression of TUBB2B mRNA CTD PMID:15336504 Tubb2b Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TUBB2B mRNA CTD PMID:32741896 Tubb2b Rat tetrachloroethene decreases expression ISO RGD:1319765 6480464 Tetrachloroethylene results in decreased expression of TUBB2B mRNA CTD PMID:28973375 Tubb2b Rat thifluzamide decreases expression ISO RGD:1602407 6480464 thifluzamide results in decreased expression of TUBB2B mRNA CTD PMID:33512557 Tubb2b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TUBB2B mRNA CTD PMID:34492290 Tubb2b Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of TUBB2B mRNA CTD PMID:30012374 Tubb2b Rat titanium dioxide decreases methylation ISO RGD:1319765 6480464 titanium dioxide results in decreased methylation of TUBB2B promoter CTD PMID:35295148 Tubb2b Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TUBB2B mRNA CTD PMID:25729387 Tubb2b Rat triclosan increases expression ISO RGD:1602407 6480464 Triclosan results in increased expression of TUBB2B mRNA CTD PMID:30510588 Tubb2b Rat valproic acid increases methylation ISO RGD:1602407 6480464 Valproic Acid results in increased methylation of TUBB2B gene CTD PMID:29154799 Tubb2b Rat valproic acid increases expression ISO RGD:1319765 6480464 Valproic Acid results in increased expression of TUBB2B mRNA CTD PMID:20546886 Tubb2b Rat valproic acid affects expression ISO RGD:1602407 6480464 Valproic Acid affects the expression of TUBB2B mRNA CTD PMID:25979313 Tubb2b Rat valproic acid increases expression ISO RGD:1602407 6480464 Valproic Acid results in increased expression of TUBB2B mRNA CTD PMID:23179753|PMID:24849673|PMID:24935251|PMID:28001369|PMID:29154799 Tubb2b Rat vitamin E increases expression ISO RGD:1602407 6480464 Vitamin E results in increased expression of TUBB2B mRNA CTD PMID:19244175 Tubb2b Rat zoledronic acid decreases expression ISO RGD:1602407 6480464 zoledronic acid results in decreased expression of TUBB2B mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-amino-4,6-dinitrotoluene (EXP) 2-methoxyethanol (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrolein (ISO) acrylamide (EXP,ISO) actinomycin D (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) amphetamine (EXP) antimycin A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) azoxystrobin (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) carbon nanotube (ISO) chloroprene (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) CU-O LINKAGE (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) diethyl phthalate (EXP) diethylstilbestrol (ISO) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) disulfiram (ISO) ethanol (EXP,ISO) fenpyroximate (ISO) ferric oxide (ISO) folic acid (ISO) furan (EXP) genistein (ISO) ivermectin (ISO) leflunomide (ISO) lipopolysaccharide (ISO) microcystin-LR (EXP) N-nitrosomorpholine (EXP) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP) pentanal (ISO) PhIP (EXP) picoxystrobin (ISO) pirinixic acid (ISO) progesterone (ISO) pyrimidifen (ISO) quercetin (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sarin (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) Soman (EXP) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) tebufenpyrad (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloroethene (ISO) thifluzamide (ISO) thioacetamide (EXP) titanium dioxide (EXP,ISO) topotecan (EXP) triclosan (ISO) valproic acid (ISO) vitamin E (ISO) zoledronic acid (ISO)
Tubb2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 30,953,086 - 30,956,133 (+) NCBI GRCr8 mRatBN7.2 17 30,747,734 - 30,750,781 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,747,734 - 30,750,638 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,560,900 - 30,563,955 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,164,652 - 32,167,707 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,556,638 - 30,559,693 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 31,441,640 - 31,444,687 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 31,441,630 - 31,482,759 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 33,336,065 - 33,339,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,087,922 - 37,090,969 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,142,086 - 37,145,700 (+) NCBI Celera 17 30,312,117 - 30,315,164 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
TUBB2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 3,224,277 - 3,227,653 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 3,223,324 - 3,231,730 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 3,224,511 - 3,227,887 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 3,169,510 - 3,172,870 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 4,453,394 - 4,456,867 (-) NCBI Celera Cytogenetic Map 6 p25.2 NCBI HuRef 6 3,102,307 - 3,105,779 (-) NCBI HuRef CHM1_1 6 3,226,964 - 3,230,437 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 3,092,680 - 3,096,055 (-) NCBI T2T-CHM13v2.0
Tubb2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 34,310,991 - 34,314,337 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 34,310,731 - 34,314,449 (-) Ensembl GRCm39 Ensembl GRCm38 13 34,127,008 - 34,130,354 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 34,126,748 - 34,130,466 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 34,218,877 - 34,222,223 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 34,134,473 - 34,137,819 (-) NCBI MGSCv36 mm8 Celera 13 35,261,212 - 35,264,555 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.04 NCBI
LOC478702 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 3,494,982 - 3,498,274 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 3,495,277 - 3,498,248 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 3,505,910 - 3,509,204 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 3,555,009 - 3,558,303 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 3,505,153 - 3,558,836 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 3,431,487 - 3,434,784 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 3,453,807 - 3,457,098 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 4,786,156 - 4,789,450 (-) NCBI UU_Cfam_GSD_1.0
LOC100624785 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 1,910,269 - 1,914,761 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 1,910,585 - 1,914,668 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 1,975,079 - 1,987,569 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
.
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 95 Interacting mature miRNAs: 100 Transcripts: ENSRNOT00000023582 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
AU047860
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 30,748,394 - 30,748,534 (+) MAPPER mRatBN7.2 Rnor_6.0 17 31,442,301 - 31,442,440 NCBI Rnor6.0 Rnor_5.0 17 33,336,726 - 33,336,865 UniSTS Rnor5.0 RGSC_v3.4 17 37,088,583 - 37,088,722 UniSTS RGSC3.4 Celera 17 30,312,778 - 30,312,917 UniSTS Cytogenetic Map 17 p12 UniSTS
RH141109
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 30,800,069 - 30,800,523 (+) MAPPER mRatBN7.2 mRatBN7.2 17 30,750,076 - 30,750,574 (+) MAPPER mRatBN7.2 Rnor_6.0 17 31,443,983 - 31,444,480 NCBI Rnor6.0 Rnor_5.0 17 33,338,408 - 33,338,905 UniSTS Rnor5.0 RGSC_v3.4 17 37,090,265 - 37,090,762 UniSTS RGSC3.4 Celera 17 30,314,460 - 30,314,957 UniSTS RH 3.4 Map 5 977.8 UniSTS Cytogenetic Map 17 p12 UniSTS
MARC_26445-26446:1030655521:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 30,749,123 - 30,749,576 (+) MAPPER mRatBN7.2 mRatBN7.2 17 30,798,685 - 30,799,569 (+) MAPPER mRatBN7.2 Rnor_6.0 17 31,494,989 - 31,495,872 NCBI Rnor6.0 Rnor_6.0 17 31,443,030 - 31,443,482 NCBI Rnor6.0 Rnor_5.0 17 33,388,175 - 33,389,058 UniSTS Rnor5.0 Rnor_5.0 17 33,337,455 - 33,337,907 UniSTS Rnor5.0 RGSC_v3.4 17 37,089,312 - 37,089,764 UniSTS RGSC3.4 RGSC_v3.4 17 37,141,022 - 37,141,905 UniSTS RGSC3.4 Celera 17 30,362,961 - 30,363,844 UniSTS Celera 17 30,313,507 - 30,313,959 UniSTS Cytogenetic Map 17 p12 UniSTS
Tubb2b
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 30,953,132 - 30,954,128 (+) Marker Load Pipeline mRatBN7.2 17 30,747,780 - 30,748,776 (+) MAPPER mRatBN7.2 Rnor_6.0 17 31,441,687 - 31,442,682 NCBI Rnor6.0 Rnor_5.0 17 33,336,112 - 33,337,107 UniSTS Rnor5.0 Celera 17 30,312,164 - 30,313,159 UniSTS Cytogenetic Map 17 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023582 ⟹ ENSRNOP00000023582
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 17 31,441,640 - 31,444,685 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083705 ⟹ ENSRNOP00000073323
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,747,734 - 30,750,638 (+) Ensembl Rnor_6.0 Ensembl 17 31,441,630 - 31,482,759 (+) Ensembl
RefSeq Acc Id:
NM_001013886 ⟹ NP_001013908
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 30,953,086 - 30,956,133 (+) NCBI mRatBN7.2 17 30,747,734 - 30,750,781 (+) NCBI Rnor_6.0 17 31,441,640 - 31,444,687 (+) NCBI Rnor_5.0 17 33,336,065 - 33,339,112 (+) NCBI RGSC_v3.4 17 37,087,922 - 37,090,969 (+) RGD Celera 17 30,312,117 - 30,315,164 (+) RGD
Sequence:
CCGGAGTAAGTTCCAGGTAGCCCAGCAGTGGGTGTGGAAGGGGAGGATCATCAGACCCACTGACCCAGACCCAAGGCAGCAAGAAGCTAACGAGGCACCATGCGAGAGATCGTGCACATTCAGGCGGG
hide sequence
RefSeq Acc Id:
NP_001013908 ⟸ NM_001013886
- UniProtKB:
A3KMR7 (UniProtKB/Swiss-Prot), P04691 (UniProtKB/Swiss-Prot), Q3KRE8 (UniProtKB/Swiss-Prot), A6J7G5 (UniProtKB/TrEMBL), A0A8L2R4U4 (UniProtKB/TrEMBL)
- Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCD
hide sequence
Ensembl Acc Id:
ENSRNOP00000023582 ⟸ ENSRNOT00000023582
Ensembl Acc Id:
ENSRNOP00000073323 ⟸ ENSRNOT00000083705
RGD ID: 13700419 Promoter ID: EPDNEW_R10935 Type: initiation region Name: Tubb2b_1 Description: tubulin, beta 2B class IIb SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 31,441,600 - 31,441,660 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-10-19
Tubb2b
tubulin, beta 2B class IIb
Tubb2b
tubulin, beta 2B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-10-12
Tubb2b
tubulin, beta 2B
Tubb2b
tubulin, beta 2B class IIb
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-10-10
Tubb2b
tubulin, beta 2B class IIb
Tubb2b
tubulin, beta 2b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Tubb2b
tubulin, beta 2b
RGD1309427
similar to tubulin, beta
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1309427
similar to tubulin, beta
RGD1309427_predicted
similar to tubulin, beta (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1309427_predicted
similar to tubulin, beta (predicted)
LOC291081_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC291081_predicted
similar to tubulin, beta (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
