Symbol:
Nfatc3
Name:
nuclear factor of activated T-cells 3
RGD ID:
1308692
Description:
Enables transcription cis-regulatory region binding activity. Involved in several processes, including positive regulation of cardiac muscle hypertrophy; positive regulation of transcription by RNA polymerase II; and protein import into nucleus. Located in cytoplasm and nucleus. Orthologous to human NFATC3 (nuclear factor of activated T cells 3); PARTICIPATES IN endothelin signaling pathway; calcineurin signaling pathway; nuclear factor of activated T-cells signaling pathway; INTERACTS WITH 1D-myo-inositol 1,4,5-trisphosphate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361400; NFAT4; NFATx; nuclear factor of activated T-cells, cytoplasmic 3; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3; T cell transcription factor NFAT4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 50,870,464 - 50,944,992 (+) NCBI GRCr8 mRatBN7.2 19 33,960,643 - 34,035,150 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 33,960,852 - 34,035,150 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 40,776,399 - 40,850,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 41,429,711 - 41,504,000 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 43,728,856 - 43,803,148 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 38,039,542 - 38,114,003 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 38,039,564 - 38,114,003 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 48,906,285 - 48,980,756 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 35,907,800 - 35,982,095 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 35,912,754 - 35,984,893 (+) NCBI Celera 19 33,388,369 - 33,462,475 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nfatc3 Rat (1->4)-beta-D-glucan multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NFATC3 mRNA CTD PMID:36331819 Nfatc3 Rat 1,2-dichloroethane increases expression ISO Nfatc3 (Mus musculus) 6480464 ethylene dichloride results in increased expression of NFATC3 mRNA CTD PMID:28960355 Nfatc3 Rat 17alpha-ethynylestradiol multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NFATC3 mRNA CTD PMID:17942748 Nfatc3 Rat 17beta-estradiol increases expression ISO Nfatc3 (Mus musculus) 6480464 Estradiol results in increased expression of NFATC3 mRNA CTD PMID:39298647 Nfatc3 Rat 1D-myo-inositol 1,4,5-trisphosphate multiple interactions EXP 6480464 Heparin inhibits the reaction [Inositol 1 more ... CTD PMID:16259952 Nfatc3 Rat 1D-myo-inositol 1,4,5-trisphosphate increases expression EXP 6480464 Inositol 1 more ... CTD PMID:16259952 Nfatc3 Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO Nfatc3 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Nfatc3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nfatc3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NFATC3 mRNA CTD PMID:21570461 more ... Nfatc3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NFATC3 mRNA CTD PMID:32109520 and PMID:34747641 Nfatc3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NFATC3 mRNA CTD PMID:17942748 Nfatc3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NFATC3 mRNA CTD PMID:21346803 Nfatc3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Nfatc3 (Mus musculus) 6480464 bisphenol S results in decreased expression of NFATC3 mRNA CTD PMID:39298647 Nfatc3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NFATC3 mRNA CTD PMID:36041667 Nfatc3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Nfatc3 (Mus musculus) 6480464 bisphenol S results in increased methylation of NFATC3 promoter CTD PMID:33297965 Nfatc3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Nfatc3 (Mus musculus) 6480464 Fenretinide results in decreased expression of NFATC3 mRNA CTD PMID:28973697 Nfatc3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NFATC3 mRNA CTD PMID:30047161 Nfatc3 Rat acrolein multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NFATC3 mRNA more ... CTD PMID:32699268 and PMID:32845096 Nfatc3 Rat acrylamide increases expression ISO NFATC3 (Homo sapiens) 6480464 Acrylamide results in increased expression of NFATC3 mRNA CTD PMID:32763439 Nfatc3 Rat aflatoxin B1 decreases methylation ISO NFATC3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NFATC3 gene CTD PMID:27153756 Nfatc3 Rat aflatoxin B1 increases methylation ISO NFATC3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NFATC3 intron CTD PMID:30157460 Nfatc3 Rat alpha-pinene multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NFATC3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of NFATC3 mRNA CTD PMID:32699268 Nfatc3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NFATC3 mRNA CTD PMID:30047161 Nfatc3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of NFATC3 mRNA CTD PMID:30779732 Nfatc3 Rat antimycin A decreases expression ISO NFATC3 (Homo sapiens) 6480464 Antimycin A results in decreased expression of NFATC3 mRNA CTD PMID:33512557 Nfatc3 Rat arecoline increases expression EXP 6480464 Arecoline results in increased expression of NFATC3 protein CTD PMID:34999050 Nfatc3 Rat aristolochic acid A decreases expression ISO NFATC3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NFATC3 mRNA CTD PMID:33212167 Nfatc3 Rat Aroclor 1254 increases expression ISO NFATC3 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NFATC3 mRNA CTD PMID:16934159 Nfatc3 Rat arsane affects expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic affects the expression of NFATC3 mRNA CTD PMID:18414638 Nfatc3 Rat arsane affects localization ISO NFATC3 (Homo sapiens) 6480464 Arsenic affects the localization of NFATC3 protein CTD PMID:31822296 Nfatc3 Rat arsane decreases expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic results in decreased expression of NFATC3 mRNA and Arsenic results in decreased expression of NFATC3 protein CTD PMID:31822296 Nfatc3 Rat arsane multiple interactions ISO NFATC3 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Arsenic affects the localization of NFATC3 protein] more ... CTD PMID:31822296 Nfatc3 Rat arsenic atom affects expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic affects the expression of NFATC3 mRNA CTD PMID:18414638 Nfatc3 Rat arsenic atom multiple interactions ISO NFATC3 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Arsenic affects the localization of NFATC3 protein] more ... CTD PMID:31822296 Nfatc3 Rat arsenic atom decreases expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic results in decreased expression of NFATC3 mRNA and Arsenic results in decreased expression of NFATC3 protein CTD PMID:31822296 Nfatc3 Rat arsenic atom affects localization ISO NFATC3 (Homo sapiens) 6480464 Arsenic affects the localization of NFATC3 protein CTD PMID:31822296 Nfatc3 Rat arsenous acid decreases expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFATC3 mRNA CTD PMID:29633893 Nfatc3 Rat ATP affects localization EXP 6480464 Adenosine Triphosphate affects the localization of NFATC3 protein CTD PMID:21464294 Nfatc3 Rat benzene decreases expression ISO NFATC3 (Homo sapiens) 6480464 Benzene results in decreased expression of NFATC3 mRNA CTD PMID:33064461 Nfatc3 Rat benzo[a]pyrene decreases expression ISO NFATC3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NFATC3 mRNA CTD PMID:20064835 Nfatc3 Rat benzo[a]pyrene increases methylation ISO NFATC3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NFATC3 promoter CTD PMID:27901495 Nfatc3 Rat beta-lapachone decreases expression ISO NFATC3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NFATC3 mRNA CTD PMID:38218311 Nfatc3 Rat bisphenol A multiple interactions ISO Nfatc3 (Mus musculus) 6480464 bisphenol A promotes the reaction [[[Tetradecanoylphorbol Acetate co-treated with Ionomycin] promotes the reaction [NFATC3 protein binds to IL4 promoter]] which results in increased expression of IL4 mRNA] more ... CTD PMID:12709020 Nfatc3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NFATC3 mRNA CTD PMID:36041667 Nfatc3 Rat bisphenol A decreases methylation ISO NFATC3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NFATC3 gene CTD PMID:31601247 Nfatc3 Rat bisphenol A affects methylation ISO Nfatc3 (Mus musculus) 6480464 bisphenol A affects the methylation of NFATC3 promoter CTD PMID:27334623 Nfatc3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NFATC3 mRNA CTD PMID:30816183 Nfatc3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NFATC3 mRNA CTD PMID:25181051 Nfatc3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NFATC3 mRNA CTD PMID:36041667 Nfatc3 Rat BQ 123 multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [cyclo(Trp-Asp-Pro-Val-Leu) co-treated with BQ 788] inhibits the reaction [EDN1 protein results in increased localization of NFATC3 protein] CTD PMID:20369390 Nfatc3 Rat cadmium atom multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NFATC3 mRNA CTD PMID:35301059 Nfatc3 Rat cadmium dichloride multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NFATC3 mRNA CTD PMID:35301059 Nfatc3 Rat caffeine affects phosphorylation ISO NFATC3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of NFATC3 protein CTD PMID:35688186 Nfatc3 Rat Calcimycin multiple interactions ISO NFATC3 (Homo sapiens) 6480464 NFATC3 protein promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of TNFSF10 protein] CTD PMID:21603612 Nfatc3 Rat cisplatin multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of NFATC3 mRNA CTD PMID:21858171 Nfatc3 Rat cisplatin increases expression ISO NFATC3 (Homo sapiens) 6480464 Cisplatin results in increased expression of NFATC3 mRNA CTD PMID:27392435 Nfatc3 Rat copper(II) sulfate decreases expression ISO NFATC3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NFATC3 mRNA CTD PMID:19549813 Nfatc3 Rat coumarin affects phosphorylation ISO NFATC3 (Homo sapiens) 6480464 coumarin affects the phosphorylation of NFATC3 protein CTD PMID:35688186 Nfatc3 Rat cyclophosphamide decreases expression ISO Nfatc3 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of NFATC3 mRNA CTD PMID:21041162 Nfatc3 Rat cyclosporin A multiple interactions EXP 6480464 Cyclosporine inhibits the reaction [Doxorubicin affects the localization of NFATC3 protein] CTD PMID:15799720 Nfatc3 Rat cyclosporin A affects localization ISO NFATC3 (Homo sapiens) 6480464 Cyclosporine affects the localization of NFATC3 protein CTD PMID:31822296 Nfatc3 Rat dexamethasone decreases expression ISO Nfatc3 (Mus musculus) 6480464 Dexamethasone results in decreased expression of NFATC3 mRNA CTD PMID:21041162 Nfatc3 Rat diarsenic trioxide decreases expression ISO NFATC3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFATC3 mRNA CTD PMID:29633893 Nfatc3 Rat diazinon increases methylation ISO NFATC3 (Homo sapiens) 6480464 Diazinon results in increased methylation of NFATC3 gene CTD PMID:22964155 Nfatc3 Rat dibenziodolium multiple interactions EXP 6480464 [diphenyleneiodonium co-treated with mitoquinol co-treated with mitoquinone] inhibits the reaction [Doxorubicin affects the localization of NFATC3 protein] CTD PMID:15799720 Nfatc3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NFATC3 mRNA CTD PMID:21266533 Nfatc3 Rat dichloromethane decreases expression EXP 6480464 Methylene Chloride results in decreased expression of NFATC3 mRNA CTD PMID:20955722 Nfatc3 Rat diethylstilbestrol decreases expression ISO Nfatc3 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of NFATC3 mRNA CTD PMID:21041162 Nfatc3 Rat diuron decreases expression ISO NFATC3 (Homo sapiens) 6480464 Diuron results in decreased expression of NFATC3 mRNA CTD PMID:35967413 Nfatc3 Rat doxorubicin affects localization EXP 6480464 Doxorubicin affects the localization of NFATC3 protein CTD PMID:15799720 Nfatc3 Rat doxorubicin multiple interactions EXP 6480464 1 more ... CTD PMID:15799720 and PMID:27181935 Nfatc3 Rat ethanol increases expression ISO NFATC3 (Homo sapiens) 6480464 Ethanol results in increased expression of NFATC3 mRNA CTD PMID:26220687 Nfatc3 Rat ethanol multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [sodium arsenite co-treated with Ethanol] results in increased expression of NFATC3 protein CTD PMID:26220687 Nfatc3 Rat ethanol multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [sodium arsenite co-treated with Ethanol] affects the localization of NFATC3 protein more ... CTD PMID:26220687 Nfatc3 Rat ethylbenzene decreases expression EXP 6480464 ethylbenzene results in decreased expression of NFATC3 mRNA CTD PMID:20955722 Nfatc3 Rat fenpyroximate decreases expression ISO NFATC3 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of NFATC3 mRNA CTD PMID:33512557 Nfatc3 Rat fenthion decreases expression ISO Nfatc3 (Mus musculus) 6480464 Fenthion results in decreased expression of NFATC3 mRNA CTD PMID:34813904 Nfatc3 Rat FR900359 decreases phosphorylation ISO NFATC3 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of NFATC3 protein CTD PMID:37730182 Nfatc3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NFATC3 mRNA CTD PMID:22061828 Nfatc3 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of NFATC3 mRNA CTD PMID:24136188 Nfatc3 Rat harmine affects localization ISO NFATC3 (Homo sapiens) 6480464 Harmine affects the localization of NFATC3 protein CTD PMID:25751815 Nfatc3 Rat heparin multiple interactions EXP 6480464 Heparin inhibits the reaction [Inositol 1 more ... CTD PMID:16259952 Nfatc3 Rat hydrogen peroxide multiple interactions EXP 6480464 1 more ... CTD PMID:15799720 Nfatc3 Rat hydrogen peroxide affects localization EXP 6480464 Hydrogen Peroxide affects the localization of NFATC3 protein CTD PMID:15799720 Nfatc3 Rat ionomycin multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] promotes the reaction [NFATC3 protein binds to IL4 promoter]] which results in increased expression of IL4 mRNA more ... CTD PMID:12709020 Nfatc3 Rat ionomycin affects localization EXP 6480464 Ionomycin affects the localization of NFATC3 protein CTD PMID:15799720 Nfatc3 Rat lithium chloride increases activity ISO Nfatc3 (Mus musculus) 6480464 Lithium Chloride results in increased activity of NFATC3 protein CTD PMID:20694829 Nfatc3 Rat methamphetamine affects localization EXP 6480464 Methamphetamine affects the localization of NFATC3 protein CTD PMID:15644446 Nfatc3 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of NFATC3 mRNA CTD PMID:19564919 Nfatc3 Rat methamphetamine multiple interactions EXP 6480464 SCH 23390 inhibits the reaction [Methamphetamine affects the localization of NFATC3 protein] CTD PMID:15644446 Nfatc3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of NFATC3 mRNA CTD PMID:30047161 Nfatc3 Rat methotrexate increases expression ISO NFATC3 (Homo sapiens) 6480464 Methotrexate results in increased expression of NFATC3 mRNA CTD PMID:17400583 Nfatc3 Rat N-acetyl-L-cysteine multiple interactions ISO NFATC3 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Arsenic affects the localization of NFATC3 protein] CTD PMID:31822296 Nfatc3 Rat Nonylphenol multiple interactions ISO Nfatc3 (Mus musculus) 6480464 nonylphenol promotes the reaction [[[Tetradecanoylphorbol Acetate co-treated with Ionomycin] promotes the reaction [NFATC3 protein binds to IL4 promoter]] which results in increased expression of IL4 mRNA] more ... CTD PMID:12709020 Nfatc3 Rat ozone multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NFATC3 mRNA more ... CTD PMID:32699268 and PMID:32845096 Nfatc3 Rat perfluorohexanesulfonic acid decreases expression ISO NFATC3 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of NFATC3 mRNA CTD PMID:25812627 Nfatc3 Rat perfluorononanoic acid decreases expression ISO NFATC3 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of NFATC3 mRNA CTD PMID:25812627 Nfatc3 Rat perfluorooctane-1-sulfonic acid decreases expression ISO NFATC3 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of NFATC3 mRNA CTD PMID:25812627 Nfatc3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NFATC3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of NFATC3 mRNA CTD PMID:36331819 Nfatc3 Rat perfluorooctanoic acid decreases expression ISO NFATC3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of NFATC3 mRNA CTD PMID:25812627 Nfatc3 Rat phenylephrine increases localization ISO Nfatc3 (Mus musculus) 6480464 Phenylephrine results in increased localization of NFATC3 protein CTD PMID:15939815 Nfatc3 Rat phenylephrine multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [NPPA protein results in increased activity of NPR1 protein] promotes the reaction [Phenylephrine results in increased localization of NFATC3 protein] CTD PMID:15939815 Nfatc3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] promotes the reaction [NFATC3 protein binds to IL4 promoter]] which results in increased expression of IL4 mRNA more ... CTD PMID:12709020 Nfatc3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO NFATC3 (Homo sapiens) 6480464 NFATC3 protein promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of TNFSF10 protein] CTD PMID:21603612 Nfatc3 Rat picoxystrobin decreases expression ISO NFATC3 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of NFATC3 mRNA CTD PMID:33512557 Nfatc3 Rat piroxicam multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of NFATC3 mRNA CTD PMID:21858171 Nfatc3 Rat platycodin D decreases expression EXP 6480464 platycodin D results in decreased expression of NFATC3 protein CTD PMID:29595072 Nfatc3 Rat rimonabant multiple interactions ISO Nfatc3 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of NFATC3 mRNA] CTD PMID:19030233 Nfatc3 Rat SCH 23390 affects expression EXP 6480464 SCH 23390 affects the expression of NFATC3 mRNA CTD PMID:19564919 Nfatc3 Rat SCH 23390 multiple interactions EXP 6480464 SCH 23390 inhibits the reaction [Methamphetamine affects the localization of NFATC3 protein] CTD PMID:15644446 Nfatc3 Rat simvastatin multiple interactions ISO NFATC3 (Homo sapiens) 6480464 Simvastatin promotes the reaction [NFATC3 protein binds to BCL2 promoter] CTD PMID:20369390 Nfatc3 Rat simvastatin increases localization ISO NFATC3 (Homo sapiens) 6480464 Simvastatin results in increased localization of NFATC3 protein CTD PMID:20369390 Nfatc3 Rat simvastatin decreases localization ISO NFATC3 (Homo sapiens) 6480464 Simvastatin results in decreased localization of NFATC3 protein alternative form CTD PMID:20369390 Nfatc3 Rat sodium arsenite multiple interactions ISO NFATC3 (Homo sapiens) 6480464 [sodium arsenite co-treated with Ethanol] affects the localization of NFATC3 protein more ... CTD PMID:26220687 Nfatc3 Rat sodium arsenite decreases expression ISO NFATC3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NFATC3 mRNA CTD PMID:38568856 Nfatc3 Rat sodium arsenite multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [sodium arsenite co-treated with Ethanol] results in increased expression of NFATC3 protein CTD PMID:26220687 Nfatc3 Rat sodium arsenite increases expression ISO NFATC3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NFATC3 mRNA CTD PMID:26220687 Nfatc3 Rat succimer multiple interactions ISO Nfatc3 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of NFATC3 mRNA CTD PMID:21641980 Nfatc3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of NFATC3 mRNA CTD PMID:30047161 Nfatc3 Rat tacrolimus hydrate multiple interactions ISO Nfatc3 (Mus musculus) 6480464 Tacrolimus inhibits the reaction [bisphenol A promotes the reaction [NFATC3 protein binds to IL4 promoter]] more ... CTD PMID:10339586 and PMID:12709020 Nfatc3 Rat tebufenpyrad decreases expression ISO NFATC3 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of NFATC3 mRNA CTD PMID:33512557 Nfatc3 Rat thapsigargin multiple interactions ISO Nfatc3 (Mus musculus) 6480464 Tacrolimus inhibits the reaction [Thapsigargin affects the localization of and results in increased activity of NFATC3 protein] and Thapsigargin affects the localization of and results in increased activity of NFATC3 protein CTD PMID:10339586 Nfatc3 Rat Theaflavin 3,3'-digallate multiple interactions EXP 6480464 theaflavin-3 and 3'-digallate inhibits the reaction [AGT protein results in decreased phosphorylation of NFATC3 protein] CTD PMID:35406003 Nfatc3 Rat titanium dioxide increases methylation ISO Nfatc3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NFATC3 gene CTD PMID:35295148 Nfatc3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NFATC3 mRNA CTD PMID:20955722 Nfatc3 Rat triphenyl phosphate affects expression ISO NFATC3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NFATC3 mRNA CTD PMID:37042841 Nfatc3 Rat troglitazone decreases expression ISO Nfatc3 (Mus musculus) 6480464 troglitazone results in decreased expression of NFATC3 mRNA CTD PMID:28973697 Nfatc3 Rat tungsten decreases expression ISO Nfatc3 (Mus musculus) 6480464 Tungsten results in decreased expression of NFATC3 mRNA CTD PMID:30912803 Nfatc3 Rat urethane increases expression ISO NFATC3 (Homo sapiens) 6480464 Urethane results in increased expression of NFATC3 mRNA CTD PMID:28818685 Nfatc3 Rat valproic acid decreases methylation ISO NFATC3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NFATC3 gene CTD PMID:29154799 Nfatc3 Rat valproic acid increases expression ISO NFATC3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NFATC3 mRNA CTD PMID:29501571 Nfatc3 Rat valproic acid increases methylation ISO NFATC3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NFATC3 gene CTD PMID:29501571 Nfatc3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NFATC3 mRNA CTD PMID:23034163 Nfatc3 Rat vitamin E decreases expression ISO NFATC3 (Homo sapiens) 6480464 Vitamin E results in decreased expression of NFATC3 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 1D-myo-inositol 1,4,5-trisphosphate (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) amitrole (EXP) amphetamine (EXP) antimycin A (ISO) arecoline (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) ATP (EXP) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) BQ 123 (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) Calcimycin (ISO) cisplatin (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclophosphamide (ISO) cyclosporin A (EXP,ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) dibenziodolium (EXP) dibutyl phthalate (EXP) dichloromethane (EXP) diethylstilbestrol (ISO) diuron (ISO) doxorubicin (EXP) ethanol (ISO) ethylbenzene (EXP) fenpyroximate (ISO) fenthion (ISO) FR900359 (ISO) gentamycin (EXP) glafenine (EXP) harmine (ISO) heparin (EXP) hydrogen peroxide (EXP) ionomycin (EXP,ISO) lithium chloride (ISO) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) N-acetyl-L-cysteine (ISO) Nonylphenol (ISO) ozone (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylephrine (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) piroxicam (ISO) platycodin D (EXP) rimonabant (ISO) SCH 23390 (EXP) simvastatin (ISO) sodium arsenite (ISO) succimer (ISO) sulfadimethoxine (EXP) tacrolimus hydrate (ISO) tebufenpyrad (ISO) thapsigargin (ISO) Theaflavin 3,3'-digallate (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
blood vessel remodeling (ISO) branching involved in blood vessel morphogenesis (ISO) calcineurin-NFAT signaling cascade (IBA,ISO) cardiac muscle hypertrophy in response to stress (ISO) cellular respiration (ISO) cellular response to calcium ion (ISO) cellular response to lithium ion (ISO) DN4 thymocyte differentiation (ISO,ISS) heart development (ISO) myotube cell development (ISO) myotube differentiation (ISO) negative regulation of miRNA transcription (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA) negative regulation of vascular associated smooth muscle cell differentiation (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of artery morphogenesis (ISO,ISS) positive regulation of cardiac muscle hypertrophy (IMP) positive regulation of DNA-templated transcription (IMP) positive regulation of nitric oxide biosynthetic process (ISO,ISS) positive regulation of transcription by RNA polymerase II (IBA,IDA,IEA,ISO,ISS) positive thymic T cell selection (ISO,ISS) protein import into nucleus (IDA) regulation of DNA-templated transcription (IEA,ISO) regulation of store-operated calcium entry (ISO) response to hypoxia (ISO) skeletal muscle fiber development (ISO) T cell differentiation (ISO) thymus development (ISO) transcription by RNA polymerase II (ISO) vascular associated smooth muscle cell development (ISO) vascular associated smooth muscle cell differentiation (ISO)
Molecular Function
chromatin binding (ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) protein binding (IPI,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) sequence-specific DNA binding (ISO) sequence-specific double-stranded DNA binding (IEA,ISO) transcription cis-regulatory region binding (IDA,ISO,ISS)
1.
CHIP attenuates lipopolysaccharide-induced cardiac hypertrophy and apoptosis by promoting NFATc3 proteasomal degradation.
Chao CN, etal., J Cell Physiol. 2019 Nov;234(11):20128-20138. doi: 10.1002/jcp.28614. Epub 2019 Apr 13.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
The pro-hypertrophic basic helix-loop-helix protein p8 is degraded by the ubiquitin/proteasome system in a protein kinase B/Akt- and glycogen synthase kinase-3-dependent manner, whereas endothelin induction of p8 mRNA and renal mesangial cell hypertrophy require NFAT4.
Goruppi S and Kyriakis JM, J Biol Chem. 2004 May 14;279(20):20950-8. Epub 2004 Mar 11.
4.
Enhanced expression of DYRK1A in cardiomyocytes inhibits acute NFAT activation but does not prevent hypertrophy in vivo.
Grebe C, etal., Cardiovasc Res. 2011 Jun 1;90(3):521-8. doi: 10.1093/cvr/cvr023. Epub 2011 Jan 27.
5.
Calcineurin/NFAT-induced up-regulation of the Fas ligand/Fas death pathway is involved in methamphetamine-induced neuronal apoptosis.
Jayanthi S, etal., Proc Natl Acad Sci U S A 2005 Jan 18;102(3):868-73. Epub 2005 Jan 11.
6.
Cross-talk between calcineurin/NFAT and Jak/STAT signalling induces cardioprotective alphaB-crystallin gene expression in response to hypertrophic stimuli.
Manukyan I, etal., J Cell Mol Med. 2010 Jun;14(6B):1707-16. doi: 10.1111/j.1582-4934.2009.00804.x. Epub 2009 Jun 16.
7.
A calcineurin-dependent transcriptional pathway for cardiac hypertrophy.
Molkentin JD, etal., Cell. 1998 Apr 17;93(2):215-28.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Calcium-calcineurin signaling in the regulation of cardiac hypertrophy.
Wilkins BJ and Molkentin JD, Biochem Biophys Res Commun. 2004 Oct 1;322(4):1178-91.
Nfatc3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 50,870,464 - 50,944,992 (+) NCBI GRCr8 mRatBN7.2 19 33,960,643 - 34,035,150 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 33,960,852 - 34,035,150 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 40,776,399 - 40,850,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 41,429,711 - 41,504,000 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 43,728,856 - 43,803,148 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 38,039,542 - 38,114,003 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 38,039,564 - 38,114,003 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 48,906,285 - 48,980,756 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 35,907,800 - 35,982,095 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 35,912,754 - 35,984,893 (+) NCBI Celera 19 33,388,369 - 33,462,475 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
NFATC3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 68,085,370 - 68,229,259 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 68,084,751 - 68,229,259 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 68,119,273 - 68,263,162 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 66,676,876 - 66,818,338 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 52,627,801 - 52,769,327 (+) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 53,992,420 - 54,136,266 (+) NCBI HuRef CHM1_1 16 69,527,224 - 69,671,199 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 73,881,124 - 74,025,006 (+) NCBI T2T-CHM13v2.0
Nfatc3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 106,785,450 - 106,857,169 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 106,785,472 - 106,857,169 (+) Ensembl GRCm39 Ensembl GRCm38 8 106,058,818 - 106,130,537 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 106,058,840 - 106,130,537 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 108,583,503 - 108,654,437 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 108,949,013 - 109,017,574 (+) NCBI MGSCv36 mm8 Celera 8 110,287,705 - 110,358,321 (+) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.08 NCBI
Nfatc3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 8,436,330 - 8,526,680 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 8,433,765 - 8,558,005 (-) NCBI ChiLan1.0 ChiLan1.0
NFATC3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 77,626,490 - 77,774,335 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 83,537,771 - 83,685,615 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 48,456,144 - 48,603,306 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 67,850,860 - 67,998,381 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 67,888,806 - 67,996,274 (+) Ensembl panpan1.1 panPan2
NFATC3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 81,294,656 - 81,434,256 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 81,296,214 - 81,434,250 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 81,284,804 - 81,424,209 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 81,729,667 - 81,869,214 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 81,729,671 - 81,869,180 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 81,556,378 - 81,695,850 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 81,238,820 - 81,378,048 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 81,880,342 - 82,019,645 (-) NCBI UU_Cfam_GSD_1.0
Nfatc3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 41,031,813 - 41,126,709 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 18,462,298 - 18,555,220 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 18,462,424 - 18,557,832 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NFATC3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 28,666,549 - 28,806,419 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 28,666,458 - 28,806,432 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 25,836,379 - 25,876,996 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NFATC3
Nfatc3
.
Predicted Target Of
Count of predictions: 1180 Count of miRNA genes: 342 Interacting mature miRNAs: 453 Transcripts: ENSRNOT00000025402 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 1549835 Tcas7 Tongue tumor susceptibility QTL 7 0.001 tongue integrity trait (VT:0010553) squamous cell carcinoma of the head and neck tumor number (CMO:0001876) 19 24817978 39654489 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1354633 Bw28 Body weight QTL 28 6.04 body mass (VT:0001259) body weight (CMO:0000012) 19 27530207 37947399 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 1354607 Gmadr1 Adrenal mass QTL 1 5.83 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 19 27530207 37947399 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 1354600 Salc2 Saline consumption QTL 2 9.91 0.001 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 19 27530207 37947399 Rat
D8Ertd281e
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 34,034,784 - 34,035,033 (+) MAPPER mRatBN7.2 Rnor_6.0 19 38,113,638 - 38,113,886 NCBI Rnor6.0 Rnor_5.0 19 48,980,391 - 48,980,639 UniSTS Rnor5.0 RGSC_v3.4 19 35,981,730 - 35,981,978 UniSTS RGSC3.4 Celera 19 33,462,110 - 33,462,358 UniSTS Cytogenetic Map 19 q12 UniSTS
RH144691
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 33,974,679 - 33,974,832 (+) MAPPER mRatBN7.2 Rnor_6.0 19 38,053,553 - 38,053,705 NCBI Rnor6.0 Rnor_5.0 19 48,920,298 - 48,920,450 UniSTS Rnor5.0 RGSC_v3.4 19 35,921,624 - 35,921,776 UniSTS RGSC3.4 Celera 19 33,402,194 - 33,402,346 UniSTS RH 3.4 Map 19 293.7 UniSTS Cytogenetic Map 19 q12 UniSTS
BI280983
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 34,035,090 - 34,035,243 (+) MAPPER mRatBN7.2 Rnor_6.0 19 38,113,944 - 38,114,096 NCBI Rnor6.0 Rnor_5.0 19 48,980,697 - 48,980,849 UniSTS Rnor5.0 RGSC_v3.4 19 35,982,036 - 35,982,188 UniSTS RGSC3.4 Celera 19 33,462,416 - 33,462,568 UniSTS RH 3.4 Map 19 293.9 UniSTS Cytogenetic Map 19 q12 UniSTS
AA850397
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 34,034,746 - 34,034,984 (+) MAPPER mRatBN7.2 Rnor_6.0 19 38,113,600 - 38,113,837 NCBI Rnor6.0 Rnor_5.0 19 48,980,353 - 48,980,590 UniSTS Rnor5.0 RGSC_v3.4 19 35,981,692 - 35,981,929 UniSTS RGSC3.4 Celera 19 33,462,072 - 33,462,309 UniSTS RH 3.4 Map 19 294.8 UniSTS Cytogenetic Map 19 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087491 ⟹ ENSRNOP00000068890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 33,960,852 - 34,033,226 (+) Ensembl Rnor_6.0 Ensembl 19 38,039,564 - 38,111,659 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089783 ⟹ ENSRNOP00000069756
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 33,960,852 - 34,035,150 (+) Ensembl Rnor_6.0 Ensembl 19 38,039,729 - 38,114,003 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105048 ⟹ ENSRNOP00000090103
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 33,960,852 - 34,033,226 (+) Ensembl
RefSeq Acc Id:
NM_001108447 ⟹ NP_001101917
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,698 - 50,944,992 (+) NCBI mRatBN7.2 19 33,960,852 - 34,035,150 (+) NCBI Rnor_6.0 19 38,039,729 - 38,114,003 (+) NCBI Rnor_5.0 19 48,906,285 - 48,980,756 (+) NCBI RGSC_v3.4 19 35,907,800 - 35,982,095 (+) RGD Celera 19 33,388,369 - 33,462,475 (+) RGD
Sequence:
CCGGCGCGGCCCAGCATGAAGCGGCGCTGAGGAGCCGCGGCGGCCGCCTGAGGAGGAGGCGCTGCACCCCGGGCCACGCCGATGACTACTGCAAACTGTGGCGCCCACGACGAGCTCGACTTTAAACT
hide sequence
RefSeq Acc Id:
XM_039097850 ⟹ XP_038953778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,941,222 (+) NCBI mRatBN7.2 19 33,960,645 - 34,031,360 (+) NCBI
RefSeq Acc Id:
XM_039097855 ⟹ XP_038953783
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,921,490 (+) NCBI mRatBN7.2 19 33,960,646 - 34,011,652 (+) NCBI
RefSeq Acc Id:
XM_063278127 ⟹ XP_063134197
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,944,987 (+) NCBI
RefSeq Acc Id:
XM_063278128 ⟹ XP_063134198
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,944,987 (+) NCBI
RefSeq Acc Id:
XM_063278129 ⟹ XP_063134199
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,944,987 (+) NCBI
RefSeq Acc Id:
XM_063278130 ⟹ XP_063134200
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,941,222 (+) NCBI
RefSeq Acc Id:
XM_063278131 ⟹ XP_063134201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,944,987 (+) NCBI
RefSeq Acc Id:
XM_063278132 ⟹ XP_063134202
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,944,987 (+) NCBI
RefSeq Acc Id:
XM_063278133 ⟹ XP_063134203
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,942,104 (+) NCBI
RefSeq Acc Id:
XM_063278134 ⟹ XP_063134204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,942,463 (+) NCBI
RefSeq Acc Id:
XM_063278135 ⟹ XP_063134205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,464 - 50,942,404 (+) NCBI
RefSeq Acc Id:
XM_063278136 ⟹ XP_063134206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 50,870,489 - 50,944,987 (+) NCBI
RefSeq Acc Id:
NP_001101917 ⟸ NM_001108447
- UniProtKB:
D3ZU59 (UniProtKB/TrEMBL), A6IYV7 (UniProtKB/TrEMBL), A0A8I6AB55 (UniProtKB/TrEMBL)
- Sequence:
MTTANCGAHDELDFKLVFGEDGAPTPVSQVSRPADLEPDDCASIYIFNVDPPPSTLNSSLGLPHHGLLQSHSSVLSPSFQLQGFKNYEGTDDISESKYSSLSGPKPFECPSIQITSISPNCHQETDAH
hide sequence
Ensembl Acc Id:
ENSRNOP00000068890 ⟸ ENSRNOT00000087491
Ensembl Acc Id:
ENSRNOP00000069756 ⟸ ENSRNOT00000089783
RefSeq Acc Id:
XP_038953778 ⟸ XM_039097850
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953783 ⟸ XM_039097855
- Peptide Label:
isoform X11
Ensembl Acc Id:
ENSRNOP00000090103 ⟸ ENSRNOT00000105048
RefSeq Acc Id:
XP_063134197 ⟸ XM_063278127
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134199 ⟸ XM_063278129
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134201 ⟸ XM_063278131
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134198 ⟸ XM_063278128
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134202 ⟸ XM_063278132
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063134204 ⟸ XM_063278134
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134205 ⟸ XM_063278135
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134203 ⟸ XM_063278133
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134200 ⟸ XM_063278130
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134206 ⟸ XM_063278136
- Peptide Label:
isoform X10
RGD ID: 13701111 Promoter ID: EPDNEW_R11625 Type: multiple initiation site Name: Nfatc3_2 Description: nuclear factor of activated T-cells 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11626 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 38,039,512 - 38,039,572 EPDNEW
RGD ID: 13701104 Promoter ID: EPDNEW_R11626 Type: multiple initiation site Name: Nfatc3_1 Description: nuclear factor of activated T-cells 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11625 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 38,039,706 - 38,039,766 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-29
Nfatc3
nuclear factor of activated T-cells 3
Nfatc3
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Nfatc3
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Nfatc3_predicted
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Nfatc3_predicted
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
