Symbol:
L3mbtl2
Name:
L3MBTL histone methyl-lysine binding protein 2
RGD ID:
1308569
Description:
Predicted to enable methylated histone binding activity and promoter-specific chromatin binding activity. Predicted to be involved in negative regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including ectoderm development; stem cell differentiation; and stem cell proliferation. Predicted to be active in nucleus. Orthologous to human L3MBTL2 (L3MBTL histone methyl-lysine binding protein 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
l(3)mbt-like 2 (Drosophila); l(3)mbt-like 2 protein; l(3)mbt-like protein 2; L3MBTL2 polycomb repressive complex 1 subunit; lethal(3)malignant brain tumor-like 2 protein; lethal(3)malignant brain tumor-like protein 2; LOC300320; MGC124862
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,066,427 - 115,087,625 (+) NCBI GRCr8 mRatBN7.2 7 113,186,303 - 113,209,706 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,186,370 - 113,207,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,949,034 - 114,970,119 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,172,532 - 117,193,617 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,141,956 - 117,163,045 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,896,860 - 122,918,025 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,896,871 - 122,918,036 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,871,375 - 122,892,521 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,016,773 - 120,037,852 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,050,975 - 120,071,944 (+) NCBI Celera 7 109,505,411 - 109,526,484 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
L3mbtl2 Rat 1,2-dimethylhydrazine increases expression ISO L3mbtl2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of L3MBTL2 mRNA CTD PMID:22206623 L3mbtl2 Rat 17alpha-ethynylestradiol multiple interactions ISO L3mbtl2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of L3MBTL2 mRNA CTD PMID:17942748 L3mbtl2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO L3mbtl2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of L3MBTL2 mRNA CTD PMID:17942748 L3mbtl2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of L3MBTL2 mRNA CTD PMID:33387578 L3mbtl2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO L3mbtl2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of L3MBTL2 mRNA CTD PMID:21570461 L3mbtl2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of L3MBTL2 mRNA CTD PMID:21346803 L3mbtl2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO L3mbtl2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of L3MBTL2 mRNA CTD PMID:20188158 L3mbtl2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of L3MBTL2 mRNA CTD PMID:28628672 L3mbtl2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of L3MBTL2 mRNA CTD PMID:36041667 L3mbtl2 Rat aflatoxin B1 increases expression ISO L3MBTL2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of L3MBTL2 mRNA CTD PMID:21641981 and PMID:22100608 L3mbtl2 Rat aflatoxin B1 increases methylation ISO L3MBTL2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of L3MBTL2 intron CTD PMID:30157460 L3mbtl2 Rat Aflatoxin B2 alpha decreases methylation ISO L3MBTL2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of L3MBTL2 intron CTD PMID:30157460 L3mbtl2 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of L3MBTL2 protein CTD PMID:34896426 L3mbtl2 Rat antirheumatic drug decreases expression ISO L3MBTL2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of L3MBTL2 mRNA CTD PMID:24449571 L3mbtl2 Rat arsane affects methylation ISO L3MBTL2 (Homo sapiens) 6480464 Arsenic affects the methylation of L3MBTL2 gene CTD PMID:25304211 L3mbtl2 Rat arsenic atom affects methylation ISO L3MBTL2 (Homo sapiens) 6480464 Arsenic affects the methylation of L3MBTL2 gene CTD PMID:25304211 L3mbtl2 Rat benzo[a]pyrene increases expression ISO L3mbtl2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of L3MBTL2 mRNA CTD PMID:22228805 L3mbtl2 Rat benzo[a]pyrene affects methylation ISO L3MBTL2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of L3MBTL2 intron CTD PMID:30157460 L3mbtl2 Rat benzo[e]pyrene decreases methylation ISO L3MBTL2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of L3MBTL2 intron CTD PMID:30157460 L3mbtl2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of L3MBTL2 mRNA and bisphenol A results in increased expression of L3MBTL2 protein CTD PMID:24552547 and PMID:25181051 L3mbtl2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of L3MBTL2 mRNA CTD PMID:36041667 L3mbtl2 Rat bisphenol F multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of L3MBTL2 mRNA CTD PMID:28628672 L3mbtl2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of L3MBTL2 mRNA CTD PMID:36041667 L3mbtl2 Rat cadmium atom multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of L3MBTL2 mRNA CTD PMID:35301059 L3mbtl2 Rat cadmium dichloride decreases expression ISO L3mbtl2 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of L3MBTL2 mRNA CTD PMID:34666113 L3mbtl2 Rat cadmium dichloride multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of L3MBTL2 mRNA CTD PMID:35301059 L3mbtl2 Rat choline multiple interactions ISO L3mbtl2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of L3MBTL2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of L3MBTL2 gene CTD PMID:20938992 L3mbtl2 Rat ciguatoxin CTX1B affects expression ISO L3mbtl2 (Mus musculus) 6480464 Ciguatoxins affects the expression of L3MBTL2 mRNA CTD PMID:18353800 L3mbtl2 Rat coumarin increases phosphorylation ISO L3MBTL2 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of L3MBTL2 protein CTD PMID:35688186 L3mbtl2 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of L3MBTL2 protein CTD PMID:34896426 L3mbtl2 Rat cylindrospermopsin increases expression ISO L3MBTL2 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of L3MBTL2 mRNA CTD PMID:24921660 L3mbtl2 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of L3MBTL2 protein CTD PMID:34896426 L3mbtl2 Rat dexamethasone multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of L3MBTL2 mRNA CTD PMID:28628672 L3mbtl2 Rat Dibutyl phosphate affects expression ISO L3MBTL2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of L3MBTL2 mRNA CTD PMID:37042841 L3mbtl2 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of L3MBTL2 protein CTD PMID:34896426 L3mbtl2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of L3MBTL2 mRNA CTD PMID:24136188 L3mbtl2 Rat folic acid multiple interactions ISO L3mbtl2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of L3MBTL2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of L3MBTL2 gene CTD PMID:20938992 L3mbtl2 Rat FR900359 increases phosphorylation ISO L3MBTL2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of L3MBTL2 protein CTD PMID:37730182 L3mbtl2 Rat indometacin multiple interactions ISO L3MBTL2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of L3MBTL2 mRNA CTD PMID:28628672 L3mbtl2 Rat L-methionine multiple interactions ISO L3mbtl2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of L3MBTL2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of L3MBTL2 gene CTD PMID:20938992 L3mbtl2 Rat methapyrilene decreases methylation ISO L3MBTL2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of L3MBTL2 intron CTD PMID:30157460 L3mbtl2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of L3MBTL2 mRNA CTD PMID:24136188 L3mbtl2 Rat paracetamol affects expression ISO L3mbtl2 (Mus musculus) 6480464 Acetaminophen affects the expression of L3MBTL2 mRNA CTD PMID:17562736 L3mbtl2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of L3MBTL2 mRNA CTD PMID:33387578 L3mbtl2 Rat pirinixic acid decreases expression ISO L3mbtl2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of L3MBTL2 mRNA CTD PMID:23811191 L3mbtl2 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of L3MBTL2 protein CTD PMID:34896426 L3mbtl2 Rat quercetin decreases phosphorylation ISO L3MBTL2 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of L3MBTL2 protein CTD PMID:35688186 L3mbtl2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of L3MBTL2 mRNA CTD PMID:23411599 L3mbtl2 Rat titanium dioxide decreases methylation ISO L3mbtl2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of L3MBTL2 promoter CTD PMID:35295148 L3mbtl2 Rat trichostatin A decreases expression ISO L3MBTL2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of L3MBTL2 mRNA CTD PMID:24935251 L3mbtl2 Rat triptonide affects expression ISO L3mbtl2 (Mus musculus) 6480464 triptonide affects the expression of L3MBTL2 mRNA CTD PMID:33045310 L3mbtl2 Rat urethane decreases expression ISO L3MBTL2 (Homo sapiens) 6480464 Urethane results in decreased expression of L3MBTL2 mRNA CTD PMID:28818685 L3mbtl2 Rat valproic acid affects expression ISO L3MBTL2 (Homo sapiens) 6480464 Valproic Acid affects the expression of L3MBTL2 mRNA CTD PMID:25979313
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) allethrin (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) bisphenol F (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) choline (ISO) ciguatoxin CTX1B (ISO) coumarin (ISO) cyhalothrin (EXP) cylindrospermopsin (ISO) cypermethrin (EXP) dexamethasone (ISO) Dibutyl phosphate (ISO) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) indometacin (ISO) L-methionine (ISO) methapyrilene (ISO) nefazodone (EXP) paracetamol (EXP,ISO) pirinixic acid (ISO) pyrethrins (EXP) quercetin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO)
L3mbtl2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,066,427 - 115,087,625 (+) NCBI GRCr8 mRatBN7.2 7 113,186,303 - 113,209,706 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,186,370 - 113,207,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,949,034 - 114,970,119 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,172,532 - 117,193,617 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,141,956 - 117,163,045 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,896,860 - 122,918,025 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,896,871 - 122,918,036 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,871,375 - 122,892,521 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,016,773 - 120,037,852 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,050,975 - 120,071,944 (+) NCBI Celera 7 109,505,411 - 109,526,484 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
L3MBTL2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 41,205,312 - 41,231,271 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 41,205,282 - 41,231,271 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 41,601,316 - 41,627,275 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 39,931,259 - 39,957,221 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 39,925,812 - 39,951,774 NCBI Celera 22 25,407,662 - 25,433,655 (+) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 24,565,907 - 24,591,739 (+) NCBI HuRef CHM1_1 22 41,560,987 - 41,586,967 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 41,680,250 - 41,706,208 (+) NCBI T2T-CHM13v2.0
L3mbtl2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 81,548,090 - 81,572,516 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 81,548,090 - 81,572,516 (+) Ensembl GRCm39 Ensembl GRCm38 15 81,663,889 - 81,688,315 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 81,663,889 - 81,688,315 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 81,494,366 - 81,518,735 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 81,491,191 - 81,515,560 (+) NCBI MGSCv36 mm8 Celera 15 83,782,718 - 83,807,411 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.19 NCBI
L3mbtl2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 26,831,066 - 26,851,859 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 26,831,065 - 26,847,638 (+) NCBI ChiLan1.0 ChiLan1.0
L3MBTL2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 51,038,016 - 51,064,031 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 53,737,939 - 53,763,951 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 22,102,348 - 22,128,351 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 40,193,492 - 40,218,925 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 40,193,492 - 40,218,925 (+) Ensembl panpan1.1 panPan2
L3MBTL2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 24,000,008 - 24,021,883 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 24,002,183 - 24,021,753 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 23,932,676 - 23,953,922 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 24,744,975 - 24,766,229 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 24,744,957 - 24,766,173 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 24,461,399 - 24,482,648 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 24,782,259 - 24,803,509 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 24,956,795 - 24,978,045 (-) NCBI UU_Cfam_GSD_1.0
L3mbtl2
L3MBTL2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 7,253,644 - 7,277,576 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 7,257,806 - 7,277,633 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 4,509,562 - 4,530,093 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
L3MBTL2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 23,749,894 - 23,774,749 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 23,750,212 - 23,776,947 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 101,649,621 - 101,674,624 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
L3mbtl2
.
Predicted Target Of
Count of predictions: 156 Count of miRNA genes: 120 Interacting mature miRNAs: 136 Transcripts: ENSRNOT00000034998 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH130689
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 115,086,588 - 115,087,479 (+) Marker Load Pipeline mRatBN7.2 7 113,206,464 - 113,207,355 (+) MAPPER mRatBN7.2 Rnor_6.0 7 122,916,989 - 122,917,879 NCBI Rnor6.0 Rnor_5.0 7 122,891,485 - 122,892,375 UniSTS Rnor5.0 RGSC_v3.4 7 120,036,821 - 120,037,711 UniSTS RGSC3.4 Celera 7 109,525,453 - 109,526,343 UniSTS RH 3.4 Map 7 880.6 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034998 ⟹ ENSRNOP00000031908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,186,370 - 113,207,489 (+) Ensembl Rnor_6.0 Ensembl 7 122,896,871 - 122,918,036 (+) Ensembl
RefSeq Acc Id:
NM_001033695 ⟹ NP_001028867
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,066,541 - 115,087,620 (+) NCBI mRatBN7.2 7 113,186,417 - 113,207,496 (+) NCBI Rnor_6.0 7 122,896,942 - 122,918,020 (+) NCBI Rnor_5.0 7 122,871,375 - 122,892,521 (+) NCBI RGSC_v3.4 7 120,016,773 - 120,037,852 (+) RGD Celera 7 109,505,411 - 109,526,484 (+) RGD
Sequence:
GGAAATTGAATTTGGTATCATGGAGAAGCCGCGGGGCACTGAGGAGACGCCATCTTCAGAGCCAATGGAAGAGGAGGAAGATGATGACTTGGAACTCTTCGGAGGCTACGATAGCTTCCGGAGTTACA
hide sequence
RefSeq Acc Id:
XM_008765711 ⟹ XP_008763933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,066,427 - 115,087,625 (+) NCBI mRatBN7.2 7 113,186,303 - 113,209,706 (+) NCBI Rnor_6.0 7 122,896,860 - 122,918,025 (+) NCBI
Sequence:
GCAGCTCGGGCGGGGTAGCCAATGAGCACACTCTCGGAGAGCGGTGAGGGCAATATGGCTTCCTGCACCTGGTGACGGTTGAGGAAATTGAATTTGGTATCATGGAGAAGCCGCGGGGCACTGAGGAG
hide sequence
RefSeq Acc Id:
XM_017594794 ⟹ XP_017450283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,069,064 - 115,087,625 (+) NCBI mRatBN7.2 7 113,186,406 - 113,209,706 (+) NCBI Rnor_6.0 7 122,896,877 - 122,918,025 (+) NCBI
Sequence:
GCCAATGAGCACACTCTCGGAGAGCGGTGAGGGCAATATGGCTTCCTGCACCTGGTGACGGTTGAGGAAATTGAATTTGGTATCATGGAGAAGCCGCGGGGCACTGAGGAGACGCCATCTTCAGAGCC
hide sequence
RefSeq Acc Id:
XM_039078957 ⟹ XP_038934885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,069,064 - 115,087,625 (+) NCBI mRatBN7.2 7 113,186,406 - 113,209,706 (+) NCBI
RefSeq Acc Id:
NP_001028867 ⟸ NM_001033695
- UniProtKB:
Q3MIF2 (UniProtKB/Swiss-Prot), A6HT06 (UniProtKB/TrEMBL), A6HT07 (UniProtKB/TrEMBL)
- Sequence:
MEKPRGTEETPSSEPMEEEEDDDLELFGGYDSFRSYNSSAGSESSSYLEESSEAENEDREAGELPTSPLHLFSSANNRALDGSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKKASIL
hide sequence
RefSeq Acc Id:
XP_008763933 ⟸ XM_008765711
- Peptide Label:
isoform X2
- UniProtKB:
A6HT07 (UniProtKB/TrEMBL)
- Sequence:
MEKPRGTEETPSSEPMEEEEDDDLELFGGYDSFRSYNSSAGSESSSYLEESSEAENEDREAGEL
hide sequence
RefSeq Acc Id:
XP_017450283 ⟸ XM_017594794
- Peptide Label:
isoform X1
- UniProtKB:
A6HT07 (UniProtKB/TrEMBL)
- Sequence:
MCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAF
hide sequence
Ensembl Acc Id:
ENSRNOP00000031908 ⟸ ENSRNOT00000034998
RefSeq Acc Id:
XP_038934885 ⟸ XM_039078957
- Peptide Label:
isoform X1
- UniProtKB:
A6HT07 (UniProtKB/TrEMBL)
RGD ID: 13695512 Promoter ID: EPDNEW_R6037 Type: multiple initiation site Name: L3mbtl2_1 Description: L3MBTL2 polycomb repressive complex 1 subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 122,896,887 - 122,896,947 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
L3mbtl2
L3MBTL histone methyl-lysine binding protein 2
L3mbtl2
L3MBTL2 polycomb repressive complex 1 subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-27
L3mbtl2
L3MBTL2 polycomb repressive complex 1 subunit
L3mbtl2
l(3)mbt-like 2 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
L3mbtl2
l(3)mbt-like 2 (Drosophila)
L3mbtl2_predicted
l(3)mbt-like 2 (Drosophila) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
L3mbtl2_predicted
l(3)mbt-like 2 (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
