Symbol:
Stk32a
Name:
serine/threonine kinase 32A
RGD ID:
1308338
Description:
Predicted to enable protein serine/threonine kinase activity. Predicted to be involved in intracellular signal transduction. Orthologous to human STK32A (serine/threonine kinase 32A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC364858; serine/threonine-protein kinase 32A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 35,509,791 - 35,620,421 (+) NCBI GRCr8 mRatBN7.2 18 35,258,865 - 35,374,985 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 35,259,052 - 35,369,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 35,363,088 - 35,472,487 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 36,081,399 - 36,190,804 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 35,458,355 - 35,567,752 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 37,597,305 - 37,706,884 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 37,597,156 - 37,710,306 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 37,253,122 - 37,366,281 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 36,501,876 - 36,611,248 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 36,537,033 - 36,646,846 (+) NCBI Celera 18 34,848,008 - 34,957,385 (+) NCBI Celera Cytogenetic Map 18 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stk32a Rat 1,2-dichloroethane affects expression ISO RGD:1318051 6480464 ethylene dichloride affects the expression of STK32A mRNA CTD PMID:28960355 Stk32a Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1318051 6480464 1,2-Dimethylhydrazine results in decreased expression of STK32A mRNA CTD PMID:22206623 Stk32a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1318051 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to STK32A promoter] CTD PMID:19654925 Stk32a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of STK32A mRNA CTD PMID:32109520 Stk32a Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in increased expression of STK32A mRNA CTD PMID:32109520 Stk32a Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1318050 6480464 bisphenol S results in decreased methylation of STK32A gene CTD PMID:31601247 Stk32a Rat acrylamide increases expression ISO RGD:1318050 6480464 Acrylamide results in increased expression of STK32A mRNA CTD PMID:32763439 Stk32a Rat all-trans-retinoic acid multiple interactions ISO RGD:1318051 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of STK32A mRNA CTD PMID:36189433 Stk32a Rat belinostat decreases expression ISO RGD:1318050 6480464 belinostat results in decreased expression of STK32A mRNA CTD PMID:27188386 Stk32a Rat benzo[a]pyrene multiple interactions ISO RGD:1318051 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to STK32A promoter] CTD PMID:19654925 Stk32a Rat benzo[a]pyrene increases expression ISO RGD:1318050 6480464 Benzo(a)pyrene results in increased expression of STK32A mRNA CTD PMID:32234424 Stk32a Rat benzo[a]pyrene increases methylation ISO RGD:1318050 6480464 Benzo(a)pyrene results in increased methylation of STK32A 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Stk32a Rat benzo[a]pyrene decreases expression ISO RGD:1318050 6480464 Benzo(a)pyrene results in decreased expression of STK32A mRNA CTD PMID:20106945 Stk32a Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1318050 6480464 Diethylhexyl Phthalate results in decreased expression of STK32A mRNA CTD PMID:31163220 Stk32a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of STK32A mRNA CTD PMID:25181051|PMID:34947998 Stk32a Rat bisphenol A decreases expression ISO RGD:1318051 6480464 bisphenol A results in decreased expression of STK32A mRNA CTD PMID:32156529 Stk32a Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of STK32A mRNA CTD PMID:19167457 Stk32a Rat cis-caffeic acid multiple interactions ISO RGD:1318050 6480464 [Thapsigargin co-treated with caffeic acid] results in decreased expression of STK32A mRNA CTD PMID:19442820 Stk32a Rat copper atom multiple interactions ISO RGD:1318050 6480464 [NSC 689534 binds to Copper] which results in increased expression of STK32A mRNA CTD PMID:20971185 Stk32a Rat copper(0) multiple interactions ISO RGD:1318050 6480464 [NSC 689534 binds to Copper] which results in increased expression of STK32A mRNA CTD PMID:20971185 Stk32a Rat cyclosporin A increases expression ISO RGD:1318050 6480464 Cyclosporine results in increased expression of STK32A mRNA CTD PMID:20106945 Stk32a Rat dorsomorphin multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Stk32a Rat entinostat decreases expression ISO RGD:1318050 6480464 entinostat results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat entinostat multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Stk32a Rat ethanol increases expression ISO RGD:1318051 6480464 Ethanol results in increased expression of STK32A mRNA CTD PMID:19167417 Stk32a Rat folic acid decreases expression ISO RGD:1318051 6480464 Folic Acid results in decreased expression of STK32A mRNA CTD PMID:25629700 Stk32a Rat GW 4064 decreases expression ISO RGD:1318051 6480464 GW 4064 results in decreased expression of STK32A mRNA CTD PMID:26655953 Stk32a Rat mercury dibromide decreases expression ISO RGD:1318050 6480464 mercuric bromide results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat mercury dibromide multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stk32a Rat methylmercury chloride decreases expression ISO RGD:1318050 6480464 methylmercuric chloride results in decreased expression of STK32A mRNA CTD PMID:28001369 Stk32a Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1318051 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of STK32A mRNA CTD PMID:36189433 Stk32a Rat N-Nitrosopyrrolidine increases expression ISO RGD:1318050 6480464 N-Nitrosopyrrolidine results in increased expression of STK32A mRNA CTD PMID:32234424 Stk32a Rat nickel atom decreases expression ISO RGD:1318050 6480464 Nickel results in decreased expression of STK32A mRNA CTD PMID:24768652|PMID:25583101 Stk32a Rat p-chloromercuribenzoic acid decreases expression ISO RGD:1318050 6480464 p-Chloromercuribenzoic Acid results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stk32a Rat panobinostat multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Stk32a Rat panobinostat decreases expression ISO RGD:1318050 6480464 panobinostat results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat paracetamol increases expression ISO RGD:1318050 6480464 Acetaminophen results in increased expression of STK32A mRNA CTD PMID:29067470 Stk32a Rat perfluorohexanesulfonic acid increases expression ISO RGD:1318051 6480464 perfluorohexanesulfonic acid results in increased expression of STK32A mRNA CTD PMID:37995155 Stk32a Rat perfluorononanoic acid increases expression ISO RGD:1318050 6480464 perfluoro-n-nonanoic acid results in increased expression of STK32A mRNA CTD PMID:32588087 Stk32a Rat phenylmercury acetate decreases expression ISO RGD:1318050 6480464 Phenylmercuric Acetate results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat phenylmercury acetate multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stk32a Rat SB 431542 multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Stk32a Rat sodium arsenite increases expression ISO RGD:1318050 6480464 sodium arsenite results in increased expression of STK32A mRNA CTD PMID:29301061|PMID:38568856 Stk32a Rat sodium arsenite decreases expression ISO RGD:1318051 6480464 sodium arsenite results in decreased expression of STK32A mRNA CTD PMID:37682722 Stk32a Rat thapsigargin multiple interactions ISO RGD:1318050 6480464 [Thapsigargin co-treated with caffeic acid] results in decreased expression of STK32A mRNA CTD PMID:19442820 Stk32a Rat thapsigargin decreases expression ISO RGD:1318050 6480464 Thapsigargin results in decreased expression of STK32A mRNA CTD PMID:19442820 Stk32a Rat titanium dioxide decreases expression ISO RGD:1318051 6480464 titanium dioxide results in decreased expression of STK32A mRNA CTD PMID:29264374 Stk32a Rat titanium dioxide increases methylation ISO RGD:1318051 6480464 titanium dioxide results in increased methylation of STK32A promoter CTD PMID:35295148 Stk32a Rat trans-caffeic acid multiple interactions ISO RGD:1318050 6480464 [Thapsigargin co-treated with caffeic acid] results in decreased expression of STK32A mRNA CTD PMID:19442820 Stk32a Rat trichostatin A decreases expression ISO RGD:1318050 6480464 trichostatin A results in decreased expression of STK32A mRNA CTD PMID:24935251|PMID:26272509 Stk32a Rat trichostatin A multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stk32a Rat troglitazone increases expression ISO RGD:1318050 6480464 troglitazone results in increased expression of STK32A mRNA CTD PMID:25572481 Stk32a Rat valproic acid decreases expression ISO RGD:1318050 6480464 Valproic Acid results in decreased expression of STK32A mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509 Stk32a Rat valproic acid increases expression ISO RGD:1318050 6480464 Valproic Acid results in increased expression of STK32A mRNA CTD PMID:28001369 Stk32a Rat valproic acid multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stk32a Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of STK32A gene CTD PMID:31682807 Stk32a Rat vorinostat multiple interactions ISO RGD:1318050 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Stk32a Rat vorinostat decreases expression ISO RGD:1318050 6480464 vorinostat results in decreased expression of STK32A mRNA CTD PMID:26272509 Stk32a Rat zoledronic acid decreases expression ISO RGD:1318050 6480464 zoledronic acid results in decreased expression of STK32A mRNA CTD PMID:24714768
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cis-caffeic acid (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) GW 4064 (ISO) mercury dibromide (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) phenylmercury acetate (ISO) SB 431542 (ISO) sodium arsenite (ISO) thapsigargin (ISO) titanium dioxide (ISO) trans-caffeic acid (ISO) trichostatin A (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zoledronic acid (ISO)
Stk32a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 35,509,791 - 35,620,421 (+) NCBI GRCr8 mRatBN7.2 18 35,258,865 - 35,374,985 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 35,259,052 - 35,369,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 35,363,088 - 35,472,487 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 36,081,399 - 36,190,804 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 35,458,355 - 35,567,752 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 37,597,305 - 37,706,884 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 37,597,156 - 37,710,306 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 37,253,122 - 37,366,281 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 36,501,876 - 36,611,248 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 36,537,033 - 36,646,846 (+) NCBI Celera 18 34,848,008 - 34,957,385 (+) NCBI Celera Cytogenetic Map 18 p11 NCBI
STK32A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 147,235,026 - 147,401,990 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 147,234,963 - 147,387,855 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 146,614,589 - 146,767,418 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 146,594,862 - 146,708,586 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 146,594,861 - 146,708,581 NCBI Celera 5 142,696,707 - 142,845,791 (+) NCBI Celera Cytogenetic Map 5 q32 NCBI HuRef 5 141,761,757 - 141,910,943 (+) NCBI HuRef CHM1_1 5 146,046,999 - 146,196,079 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 147,770,995 - 147,937,774 (+) NCBI T2T-CHM13v2.0
Stk32a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 43,340,762 - 43,450,546 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 43,340,648 - 43,451,747 (+) Ensembl GRCm39 Ensembl GRCm38 18 43,207,697 - 43,317,481 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 43,207,583 - 43,318,682 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 43,367,351 - 43,477,135 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 43,333,028 - 43,442,812 (+) NCBI MGSCv36 mm8 Celera 18 44,582,297 - 44,700,893 (+) NCBI Celera Cytogenetic Map 18 B3 NCBI cM Map 18 23.17 NCBI
Stk32a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 6,815,852 - 6,948,232 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 6,817,152 - 6,948,180 (-) NCBI ChiLan1.0 ChiLan1.0
STK32A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 142,487,472 - 142,641,759 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 140,627,099 - 140,781,312 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 142,683,261 - 142,868,491 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 148,694,879 - 148,848,227 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 148,694,879 - 148,844,508 (+) Ensembl panpan1.1 panPan2
STK32A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 41,555,314 - 41,686,016 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 41,559,019 - 41,683,496 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 38,597,167 - 38,727,788 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 42,010,369 - 42,141,271 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 42,010,123 - 42,138,189 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 39,086,862 - 39,217,202 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 39,893,973 - 40,027,318 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 40,718,283 - 40,849,352 (+) NCBI UU_Cfam_GSD_1.0
Stk32a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 145,797,205 - 145,936,117 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936504 7,370,332 - 7,510,562 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936504 7,369,180 - 7,510,016 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STK32A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 148,519,679 - 148,659,461 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 148,519,808 - 148,663,591 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 155,283,793 - 155,320,647 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STK32A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 49,786,215 - 49,935,407 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 49,786,283 - 49,939,332 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 27,827,660 - 27,980,790 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stk32a
.
Predicted Target Of
Count of predictions: 42 Count of miRNA genes: 39 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000031370 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2301413 Bp318 Blood pressure QTL 318 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 26548082 46969551 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61388 Bp2 Blood pressure QTL 2 3.23 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 1 35374722 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 12904668 Bw188 Body weight QTL 188 0.03 body mass (VT:0001259) body weight (CMO:0000012) 18 26548082 46969551 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 12904669 Cm125 Cardiac mass QTL 125 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 26548082 46969551 Rat 1641923 Colcr8 Colorectal carcinoma resistance QTL 8 3.1 0.0014 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 18 22066242 52293055 Rat 12904670 Cm126 Cardiac mass QTL 126 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 26548082 46969551 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 2312568 Glom21 Glomerulus QTL 21 2 0.005 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 18 5185858 40503530 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 12904677 Kidm72 Kidney mass QTL 72 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 26548082 46969551 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 12904673 Cm127 Cardiac mass QTL 127 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 26548082 46969551 Rat 12904675 Am19 Aortic mass QTL 19 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 26548082 46969551 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331753 Bp231 Blood pressure QTL 231 3.643 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944299 52293055 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 61375 Bp41 Blood pressure QTL 41 2.4 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 18 11944299 41122201 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
29
109
58
57
26
25
26
6
165
77
89
45
55
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000031370 ⟹ ENSRNOP00000036737
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 35,259,052 - 35,369,451 (+) Ensembl Rnor_6.0 Ensembl 18 37,597,156 - 37,710,306 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115603 ⟹ ENSRNOP00000079735
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 35,259,052 - 35,369,451 (+) Ensembl
RefSeq Acc Id:
NM_001191894 ⟹ NP_001178823
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 35,509,982 - 35,619,381 (+) NCBI mRatBN7.2 18 35,259,052 - 35,368,451 (+) NCBI Rnor_6.0 18 37,597,305 - 37,706,884 (+) NCBI Rnor_5.0 18 37,253,122 - 37,366,281 (+) NCBI Celera 18 34,848,008 - 34,957,385 (+) NCBI
Sequence:
AGCGGCAGGTGCCTGAGCCCAGCGAGCAGTCCTGCCAGGGCCATTCCCTCAACCGCGTCCTGATCCGCAGGTGTCTTCTGTATCTGTCTTTCCTGGCCTGCTGAGTTCTGTCAGCCTCTGCTCCTCGA
hide sequence
RefSeq Acc Id:
XM_039097002 ⟹ XP_038952930
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 35,509,791 - 35,620,421 (+) NCBI mRatBN7.2 18 35,258,865 - 35,374,985 (+) NCBI
RefSeq Acc Id:
XM_063277491 ⟹ XP_063133561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 35,514,038 - 35,620,421 (+) NCBI
RefSeq Acc Id:
NP_001178823 ⟸ NM_001191894
- UniProtKB:
D3ZD18 (UniProtKB/TrEMBL), A0A8I5ZNQ1 (UniProtKB/TrEMBL)
- Sequence:
MGANTSSKAPVLDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFIC
hide sequence
Ensembl Acc Id:
ENSRNOP00000036737 ⟸ ENSRNOT00000031370
RefSeq Acc Id:
XP_038952930 ⟸ XM_039097002
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZNQ1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000079735 ⟸ ENSRNOT00000115603
RefSeq Acc Id:
XP_063133561 ⟸ XM_063277491
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZNQ1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Stk32a
serine/threonine kinase 32A
Stk32a_predicted
serine/threonine kinase 32A (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Stk32a_predicted
serine/threonine kinase 32A (predicted)
Symbol and Name status set to approved
70820 APPROVED
