Symbol:
Kdsr
Name:
3-ketodihydrosphingosine reductase
RGD ID:
1307775
Description:
Predicted to enable 3-dehydrosphinganine reductase activity. Predicted to be involved in 3-keto-sphinganine metabolic process and sphingolipid biosynthetic process. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in erythrokeratodermia variabilis et progressiva 4 and follicular lymphoma. Orthologous to human KDSR (3-ketodihydrosphingosine reductase); PARTICIPATES IN Fabry disease pathway; Gaucher's disease pathway; Krabbe disease pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
follicular lymphoma variant translocation 1; Fvt1; LOC360833
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KDSR (3-ketodihydrosphingosine reductase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kdsr (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kdsr (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KDSR (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KDSR (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kdsr (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KDSR (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KDSR (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kdsr (3-ketodihydrosphingosine reductase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PDX1 (pancreatic and duodenal homeobox 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
KDSR (3-ketodihydrosphingosine reductase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kdsr (3-ketodihydrosphingosine reductase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdsr (3-ketodihydrosphingosine reductase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG10425
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TSC10
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
Y37E11AM.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kdsr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 23,374,101 - 23,408,779 (-) NCBI GRCr8 mRatBN7.2 13 22,862,117 - 22,894,118 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 22,862,117 - 22,894,108 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 23,184,947 - 23,216,962 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 24,469,418 - 24,501,431 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 23,155,132 - 23,187,149 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 26,779,386 - 26,812,271 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 26,780,633 - 26,812,215 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 31,929,862 - 31,962,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 12,914,967 - 12,946,853 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 12,914,896 - 12,946,797 (-) NCBI Celera 13 22,721,005 - 22,752,490 (-) NCBI Celera Cytogenetic Map 13 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdsr Rat (1->4)-beta-D-glucan multiple interactions ISO Kdsr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KDSR mRNA CTD PMID:36331819 Kdsr Rat 1,2-dichloroethane decreases expression ISO Kdsr (Mus musculus) 6480464 ethylene dichloride results in decreased expression of KDSR mRNA CTD PMID:28189721 and PMID:28960355 Kdsr Rat 1,2-dimethylhydrazine decreases expression ISO Kdsr (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KDSR mRNA CTD PMID:22206623 Kdsr Rat 17beta-estradiol decreases expression ISO Kdsr (Mus musculus) 6480464 Estradiol results in decreased expression of KDSR mRNA CTD PMID:39298647 Kdsr Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Kdsr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO KDSR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KDSR mRNA CTD PMID:23152189 Kdsr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kdsr (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KDSR mRNA CTD PMID:28238261 Kdsr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KDSR mRNA CTD PMID:22298810 Kdsr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kdsr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KDSR mRNA CTD PMID:20702594 Kdsr Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Kdsr (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Kdsr Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KDSR mRNA CTD PMID:30071829 Kdsr Rat 4,4'-sulfonyldiphenol decreases expression ISO Kdsr (Mus musculus) 6480464 bisphenol S results in decreased expression of KDSR mRNA CTD PMID:39298647 Kdsr Rat 4,4'-sulfonyldiphenol increases expression ISO KDSR (Homo sapiens) 6480464 bisphenol S results in increased expression of KDSR protein CTD PMID:34186270 Kdsr Rat 4-hydroxyphenyl retinamide decreases expression ISO Kdsr (Mus musculus) 6480464 Fenretinide results in decreased expression of KDSR mRNA CTD PMID:28973697 Kdsr Rat all-trans-retinoic acid increases expression ISO KDSR (Homo sapiens) 6480464 Tretinoin results in increased expression of KDSR mRNA CTD PMID:23724009 Kdsr Rat all-trans-retinoic acid decreases expression ISO KDSR (Homo sapiens) 6480464 Tretinoin results in decreased expression of KDSR mRNA CTD PMID:33167477 Kdsr Rat Aroclor 1254 decreases expression ISO Kdsr (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KDSR mRNA CTD PMID:23650126 Kdsr Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of KDSR mRNA CTD PMID:36841081 Kdsr Rat Benoxacor increases expression ISO Kdsr (Mus musculus) 6480464 benoxacor results in increased expression of KDSR mRNA CTD PMID:34850242 Kdsr Rat benzo[a]pyrene increases expression ISO Kdsr (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KDSR mRNA CTD PMID:21569818 Kdsr Rat benzo[a]pyrene diol epoxide I increases expression ISO KDSR (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Kdsr Rat bis(2-ethylhexyl) phthalate increases expression ISO Kdsr (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KDSR mRNA CTD PMID:19850644 Kdsr Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Kdsr (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of KDSR mRNA] CTD PMID:19850644 Kdsr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KDSR mRNA CTD PMID:25181051 more ... Kdsr Rat bisphenol A increases expression ISO KDSR (Homo sapiens) 6480464 bisphenol A results in increased expression of KDSR mRNA and bisphenol A results in increased expression of KDSR protein CTD PMID:29275510 and PMID:34186270 Kdsr Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KDSR gene CTD PMID:28505145 Kdsr Rat bisphenol AF increases expression ISO KDSR (Homo sapiens) 6480464 bisphenol AF results in increased expression of KDSR protein CTD PMID:34186270 Kdsr Rat carbamazepine affects expression ISO KDSR (Homo sapiens) 6480464 Carbamazepine affects the expression of KDSR mRNA CTD PMID:25979313 Kdsr Rat carbon nanotube increases expression ISO Kdsr (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kdsr Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of KDSR mRNA CTD PMID:23125180 Kdsr Rat clofibrate increases expression ISO Kdsr (Mus musculus) 6480464 Clofibrate results in increased expression of KDSR mRNA CTD PMID:23811191 Kdsr Rat copper(II) sulfate increases expression ISO KDSR (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KDSR mRNA CTD PMID:19549813 Kdsr Rat cyclosporin A decreases expression ISO KDSR (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KDSR mRNA CTD PMID:25562108 Kdsr Rat Dibutyl phosphate affects expression ISO KDSR (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KDSR mRNA CTD PMID:37042841 Kdsr Rat dichloroacetic acid increases expression ISO Kdsr (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of KDSR mRNA CTD PMID:28962523 and PMID:34850242 Kdsr Rat dorsomorphin multiple interactions ISO KDSR (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kdsr Rat doxorubicin increases response to substance ISO KDSR (Homo sapiens) 6480464 KDSR mRNA results in increased susceptibility to Doxorubicin CTD PMID:16322897 Kdsr Rat endosulfan increases expression ISO KDSR (Homo sapiens) 6480464 Endosulfan results in increased expression of KDSR mRNA CTD PMID:26615145 Kdsr Rat gallic acid decreases expression ISO KDSR (Homo sapiens) 6480464 Gallic Acid results in decreased expression of KDSR mRNA CTD PMID:34408198 Kdsr Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KDSR mRNA CTD PMID:33387578 Kdsr Rat inulin multiple interactions ISO Kdsr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of KDSR mRNA CTD PMID:36331819 Kdsr Rat levonorgestrel multiple interactions ISO KDSR (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of KDSR mRNA CTD PMID:19074003 Kdsr Rat mercury dichloride multiple interactions ISO KDSR (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KDSR mRNA CTD PMID:27188386 Kdsr Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of KDSR gene CTD PMID:33148267 Kdsr Rat NADP zwitterion multiple interactions ISO KDSR (Homo sapiens) 6480464 NADP binds to and results in increased activity of KDSR protein CTD PMID:25526675 Kdsr Rat NADP(+) multiple interactions ISO KDSR (Homo sapiens) 6480464 NADP binds to and results in increased activity of KDSR protein CTD PMID:25526675 Kdsr Rat paracetamol decreases expression ISO KDSR (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KDSR mRNA CTD PMID:21420995 Kdsr Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KDSR mRNA CTD PMID:33387578 Kdsr Rat paracetamol affects expression ISO Kdsr (Mus musculus) 6480464 Acetaminophen affects the expression of KDSR mRNA CTD PMID:17562736 Kdsr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Kdsr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KDSR mRNA more ... CTD PMID:36331819 Kdsr Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of KDSR gene CTD PMID:33148267 Kdsr Rat phenylmercury acetate increases expression ISO KDSR (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of KDSR mRNA CTD PMID:26272509 Kdsr Rat phenylmercury acetate multiple interactions ISO KDSR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KDSR mRNA CTD PMID:27188386 Kdsr Rat pirinixic acid increases expression ISO Kdsr (Mus musculus) 6480464 pirinixic acid results in increased expression of KDSR mRNA CTD PMID:18301758 more ... Kdsr Rat potassium dichromate increases expression ISO KDSR (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of KDSR protein CTD PMID:23718831 Kdsr Rat progesterone increases expression ISO KDSR (Homo sapiens) 6480464 Progesterone results in increased expression of KDSR mRNA CTD PMID:18070364 Kdsr Rat SB 431542 increases expression ISO KDSR (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of KDSR protein CTD PMID:25670856 Kdsr Rat SB 431542 multiple interactions ISO KDSR (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kdsr Rat silicon dioxide increases expression ISO KDSR (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of KDSR mRNA CTD PMID:25895662 Kdsr Rat silver atom decreases expression ISO Kdsr (Mus musculus) 6480464 Silver results in decreased expression of KDSR mRNA CTD PMID:27131904 Kdsr Rat silver(0) decreases expression ISO Kdsr (Mus musculus) 6480464 Silver results in decreased expression of KDSR mRNA CTD PMID:27131904 Kdsr Rat sunitinib increases expression ISO KDSR (Homo sapiens) 6480464 Sunitinib results in increased expression of KDSR mRNA CTD PMID:31533062 Kdsr Rat tert-butyl hydroperoxide increases expression ISO KDSR (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of KDSR mRNA CTD PMID:15336504 Kdsr Rat testosterone undecanoate multiple interactions ISO KDSR (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of KDSR mRNA CTD PMID:19074003 Kdsr Rat tetrachloroethene increases expression ISO Kdsr (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of KDSR mRNA CTD PMID:28973375 Kdsr Rat tetrachloromethane affects expression ISO Kdsr (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of KDSR mRNA CTD PMID:17484886 Kdsr Rat titanium dioxide decreases methylation ISO Kdsr (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KDSR gene and titanium dioxide results in decreased methylation of KDSR promoter CTD PMID:35295148 Kdsr Rat trichloroethene increases expression ISO Kdsr (Mus musculus) 6480464 Trichloroethylene results in increased expression of KDSR mRNA CTD PMID:25549359 Kdsr Rat trichostatin A increases expression ISO KDSR (Homo sapiens) 6480464 trichostatin A results in increased expression of KDSR mRNA CTD PMID:24935251 Kdsr Rat triphenyl phosphate affects expression ISO KDSR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KDSR mRNA CTD PMID:37042841 Kdsr Rat urethane increases expression ISO KDSR (Homo sapiens) 6480464 Urethane results in increased expression of KDSR mRNA CTD PMID:28818685 Kdsr Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of KDSR mRNA CTD PMID:24136188 Kdsr Rat valproic acid decreases methylation ISO KDSR (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of KDSR gene CTD PMID:29154799 Kdsr Rat valproic acid increases expression ISO KDSR (Homo sapiens) 6480464 Valproic Acid results in increased expression of KDSR mRNA CTD PMID:23179753 more ... Kdsr Rat vincristine decreases expression ISO KDSR (Homo sapiens) 6480464 Vincristine results in decreased expression of KDSR mRNA CTD PMID:23649840
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) all-trans-retinoic acid (ISO) Aroclor 1254 (ISO) atrazine (EXP) Benoxacor (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloroprene (EXP) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dichloroacetic acid (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) gallic acid (ISO) gentamycin (EXP) inulin (ISO) levonorgestrel (ISO) mercury dichloride (ISO) N,N-diethyl-m-toluamide (EXP) NADP zwitterion (ISO) NADP(+) (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone undecanoate (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vincristine (ISO)
Kdsr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 23,374,101 - 23,408,779 (-) NCBI GRCr8 mRatBN7.2 13 22,862,117 - 22,894,118 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 22,862,117 - 22,894,108 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 23,184,947 - 23,216,962 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 24,469,418 - 24,501,431 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 23,155,132 - 23,187,149 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 26,779,386 - 26,812,271 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 26,780,633 - 26,812,215 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 31,929,862 - 31,962,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 12,914,967 - 12,946,853 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 12,914,896 - 12,946,797 (-) NCBI Celera 13 22,721,005 - 22,752,490 (-) NCBI Celera Cytogenetic Map 13 p11 NCBI
KDSR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 63,327,726 - 63,367,206 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 63,327,726 - 63,367,228 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 60,994,959 - 61,034,439 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 59,145,951 - 59,185,486 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 59,148,812 - 59,185,438 NCBI Celera 18 57,714,472 - 57,754,142 (-) NCBI Celera Cytogenetic Map 18 q21.33 NCBI HuRef 18 57,693,465 - 57,733,080 (-) NCBI HuRef CHM1_1 18 60,990,909 - 61,030,493 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 63,532,776 - 63,572,250 (-) NCBI T2T-CHM13v2.0
Kdsr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 106,648,140 - 106,689,544 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 106,648,189 - 106,687,457 (-) Ensembl GRCm39 Ensembl GRCm38 1 106,720,410 - 106,759,742 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 106,720,459 - 106,759,727 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 108,616,987 - 108,656,319 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 108,551,436 - 108,587,347 (-) NCBI MGSCv36 mm8 Celera 1 109,569,745 - 109,609,088 (-) NCBI Celera Cytogenetic Map 1 E2.1 NCBI cM Map 1 49.99 NCBI
Kdsr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 47,092,779 - 47,130,132 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 47,092,779 - 47,130,131 (-) NCBI ChiLan1.0 ChiLan1.0
KDSR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 80,840,824 - 80,878,698 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 66,530,449 - 66,571,494 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 56,686,914 - 56,727,681 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 60,003,576 - 60,040,365 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 60,001,637 - 60,036,292 (-) Ensembl panpan1.1 panPan2
KDSR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 13,682,838 - 13,726,872 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 13,689,246 - 13,723,528 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 14,654,928 - 14,692,956 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 13,550,434 - 13,588,484 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 13,550,483 - 13,585,739 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 13,588,547 - 13,626,566 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 13,517,813 - 13,555,882 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 13,766,595 - 13,804,675 (+) NCBI UU_Cfam_GSD_1.0
Kdsr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 26,931,216 - 26,960,699 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 2,169,712 - 2,203,150 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 2,169,982 - 2,199,600 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KDSR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 158,288,544 - 158,329,881 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 158,288,544 - 158,329,898 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 175,775,310 - 175,822,928 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KDSR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 16,392,714 - 16,429,912 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 16,392,756 - 16,434,035 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666060 9,258,194 - 9,295,466 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdsr
.
Predicted Target Of
Count of predictions: 233 Count of miRNA genes: 158 Interacting mature miRNAs: 198 Transcripts: ENSRNOT00000003728 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2317027 Aia22 Adjuvant induced arthritis QTL 22 2.29 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 13 1 34266636 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 2317034 Aia9 Adjuvant induced arthritis QTL 9 4.62 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 11766535 32331607 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 631672 Iddm12 Insulin dependent diabetes mellitus QTL 12 2.2 0.0032 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 5994668 34535351 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 2303031 Bp326 Blood pressure QTL 326 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 11766535 23001904 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 2317044 Aia23 Adjuvant induced arthritis QTL 23 2.3 joint integrity trait (VT:0010548) ankle joint diameter (CMO:0002148) 13 11766535 32331607 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 738036 Lnnr4 Liver neoplastic nodule remodeling QTL 4 3.64 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 1 42356786 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
BE100511
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 22,862,523 - 22,862,683 (+) MAPPER mRatBN7.2 Rnor_6.0 13 26,779,793 - 26,779,952 NCBI Rnor6.0 Rnor_5.0 13 31,930,269 - 31,930,428 UniSTS Rnor5.0 RGSC_v3.4 13 12,915,374 - 12,915,533 UniSTS RGSC3.4 Celera 13 22,721,412 - 22,721,571 UniSTS Cytogenetic Map 13 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003728 ⟹ ENSRNOP00000003728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 22,862,590 - 22,894,100 (-) Ensembl Rnor_6.0 Ensembl 13 26,780,633 - 26,812,215 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090097 ⟹ ENSRNOP00000073187
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 22,862,117 - 22,889,925 (-) Ensembl Rnor_6.0 Ensembl 13 26,780,633 - 26,811,904 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099177 ⟹ ENSRNOP00000085720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 22,862,117 - 22,893,189 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099271 ⟹ ENSRNOP00000093847
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 22,862,117 - 22,894,108 (-) Ensembl
RefSeq Acc Id:
NM_001108342 ⟹ NP_001101812
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 23,376,779 - 23,408,765 (-) NCBI mRatBN7.2 13 22,862,117 - 22,894,108 (-) NCBI Rnor_6.0 13 26,779,386 - 26,812,271 (-) NCBI Rnor_5.0 13 31,929,862 - 31,962,754 (-) NCBI RGSC_v3.4 13 12,914,967 - 12,946,853 (-) RGD Celera 13 22,721,005 - 22,752,490 (-) RGD
Sequence:
CGCCCTCTCCCGCAAACCCAAACACTCCCGGCTGCTGGTGCATGTGATCTCCCAGTAGACGCTCGGGCAGAGAGATGTTGCTGCTGGCCGCCGCCGGCCTCGTGGCCTTCGTGCTACTCCTCTACATG
hide sequence
RefSeq Acc Id:
XM_039090876 ⟹ XP_038946804
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 23,374,101 - 23,408,779 (-) NCBI mRatBN7.2 13 22,862,577 - 22,894,118 (-) NCBI
RefSeq Acc Id:
NP_001101812 ⟸ NM_001108342
- UniProtKB:
A0A8I6AMK1 (UniProtKB/TrEMBL), A6JSV0 (UniProtKB/TrEMBL), A6JSU9 (UniProtKB/TrEMBL)
- Sequence:
MLLLAAAGLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKYSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSKSG
hide sequence
Ensembl Acc Id:
ENSRNOP00000073187 ⟸ ENSRNOT00000090097
Ensembl Acc Id:
ENSRNOP00000003728 ⟸ ENSRNOT00000003728
RefSeq Acc Id:
XP_038946804 ⟸ XM_039090876
- Peptide Label:
isoform X1
- UniProtKB:
D3Z9P1 (UniProtKB/TrEMBL), A6JSU9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093847 ⟸ ENSRNOT00000099271
Ensembl Acc Id:
ENSRNOP00000085720 ⟸ ENSRNOT00000099177
RGD ID: 13698749 Promoter ID: EPDNEW_R9274 Type: single initiation site Name: Kdsr_2 Description: 3-ketodihydrosphingosine reductase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9275 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 26,811,302 - 26,811,362 EPDNEW
RGD ID: 13698750 Promoter ID: EPDNEW_R9275 Type: initiation region Name: Kdsr_1 Description: 3-ketodihydrosphingosine reductase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9274 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 26,812,218 - 26,812,278 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-06-27
Kdsr
3-ketodihydrosphingosine reductase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-11
Kdsr
3-ketodihydrosphingosine reductase
Fvt1_predicted
follicular lymphoma variant translocation 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Fvt1_predicted
follicular lymphoma variant translocation 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
