Symbol:
Mpdu1
Name:
mannose-P-dolichol utilization defect 1
RGD ID:
1307699
Description:
Predicted to be involved in oligosaccharide biosynthetic process. Predicted to be located in membrane. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation If. Orthologous to human MPDU1 (mannose-P-dolichol utilization defect 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC303244; mannose-P-dolichol utilization defect 1 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,873,467 - 54,880,536 (-) NCBI GRCr8 mRatBN7.2 10 54,374,719 - 54,380,301 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,374,725 - 54,380,447 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,037,360 - 59,042,938 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,525,912 - 58,531,490 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,033,517 - 54,039,095 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,261,636 - 56,267,213 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,261,637 - 56,267,213 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,007,275 - 56,012,851 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,474,179 - 56,480,188 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,487,803 - 56,493,840 (-) NCBI Celera 10 53,529,250 - 53,534,838 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mpdu1 Rat 1,2-dichloroethane decreases expression ISO Mpdu1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of MPDU1 mRNA CTD PMID:28960355 Mpdu1 Rat 1,2-dimethylhydrazine multiple interactions ISO Mpdu1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MPDU1 mRNA CTD PMID:22206623 Mpdu1 Rat 17alpha-ethynylestradiol affects expression ISO Mpdu1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of MPDU1 mRNA CTD PMID:17555576 Mpdu1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Mpdu1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mpdu1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MPDU1 mRNA CTD PMID:21570461 Mpdu1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MPDU1 mRNA CTD PMID:32109520 Mpdu1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MPDU1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MPDU1 mRNA CTD PMID:22574217 Mpdu1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Mpdu1 Rat 4,4'-sulfonyldiphenol increases expression ISO Mpdu1 (Mus musculus) 6480464 bisphenol S results in increased expression of MPDU1 mRNA CTD PMID:39298647 Mpdu1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MPDU1 mRNA CTD PMID:36041667 Mpdu1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MPDU1 mRNA CTD PMID:28959563 Mpdu1 Rat all-trans-retinoic acid increases expression ISO MPDU1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MPDU1 mRNA CTD PMID:15894607 Mpdu1 Rat all-trans-retinoic acid multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of MPDU1 mRNA CTD PMID:15894607 Mpdu1 Rat aristolochic acid A decreases expression ISO MPDU1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MPDU1 mRNA CTD PMID:33212167 Mpdu1 Rat arsane multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MPDU1 mRNA CTD PMID:39836092 Mpdu1 Rat arsenic atom multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MPDU1 mRNA CTD PMID:39836092 Mpdu1 Rat arsenous acid multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of MPDU1 mRNA CTD PMID:15894607 Mpdu1 Rat atrazine decreases expression ISO MPDU1 (Homo sapiens) 6480464 Atrazine results in decreased expression of MPDU1 mRNA CTD PMID:22378314 Mpdu1 Rat benzo[a]pyrene decreases expression ISO MPDU1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MPDU1 mRNA CTD PMID:20106945 Mpdu1 Rat benzo[a]pyrene increases methylation ISO MPDU1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MPDU1 promoter CTD PMID:27901495 Mpdu1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MPDU1 mRNA CTD PMID:25181051 Mpdu1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MPDU1 mRNA CTD PMID:36041667 Mpdu1 Rat bisphenol A multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MPDU1 gene CTD PMID:31601247 Mpdu1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MPDU1 mRNA CTD PMID:30816183 Mpdu1 Rat bisphenol F increases expression ISO Mpdu1 (Mus musculus) 6480464 bisphenol F results in increased expression of MPDU1 mRNA CTD PMID:38685157 Mpdu1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MPDU1 mRNA CTD PMID:36041667 Mpdu1 Rat carbon nanotube increases expression ISO Mpdu1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of MPDU1 mRNA CTD PMID:25554681 Mpdu1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MPDU1 mRNA CTD PMID:18668222 Mpdu1 Rat chlorpyrifos increases expression ISO Mpdu1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MPDU1 mRNA CTD PMID:37019170 Mpdu1 Rat chrysene decreases expression ISO Mpdu1 (Mus musculus) 6480464 chrysene results in decreased expression of MPDU1 mRNA CTD PMID:26377693 Mpdu1 Rat cyclosporin A decreases expression ISO MPDU1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MPDU1 mRNA CTD PMID:25562108 Mpdu1 Rat diarsenic trioxide multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of MPDU1 mRNA CTD PMID:15894607 Mpdu1 Rat Dibutyl phosphate affects expression ISO MPDU1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MPDU1 mRNA CTD PMID:37042841 Mpdu1 Rat doxorubicin decreases expression ISO MPDU1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MPDU1 mRNA CTD PMID:29803840 Mpdu1 Rat entinostat decreases expression ISO MPDU1 (Homo sapiens) 6480464 entinostat results in decreased expression of MPDU1 mRNA CTD PMID:27188386 Mpdu1 Rat folic acid multiple interactions ISO Mpdu1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MPDU1 mRNA CTD PMID:22206623 Mpdu1 Rat folic acid increases expression ISO Mpdu1 (Mus musculus) 6480464 Folic Acid results in increased expression of MPDU1 mRNA CTD PMID:25629700 Mpdu1 Rat fulvestrant multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MPDU1 gene CTD PMID:31601247 Mpdu1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MPDU1 mRNA CTD PMID:33387578 Mpdu1 Rat inulin multiple interactions ISO Mpdu1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MPDU1 mRNA CTD PMID:36331819 Mpdu1 Rat ivermectin decreases expression ISO MPDU1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MPDU1 protein CTD PMID:32959892 Mpdu1 Rat lead(0) affects expression ISO MPDU1 (Homo sapiens) 6480464 Lead affects the expression of MPDU1 mRNA CTD PMID:28903495 Mpdu1 Rat methidathion increases expression ISO Mpdu1 (Mus musculus) 6480464 methidathion results in increased expression of MPDU1 mRNA CTD PMID:34813904 Mpdu1 Rat ochratoxin A decreases expression ISO MPDU1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of MPDU1 mRNA CTD PMID:19287073 Mpdu1 Rat paracetamol affects expression ISO Mpdu1 (Mus musculus) 6480464 Acetaminophen affects the expression of MPDU1 mRNA CTD PMID:17562736 Mpdu1 Rat parathion increases expression ISO Mpdu1 (Mus musculus) 6480464 Parathion results in increased expression of MPDU1 mRNA CTD PMID:34813904 Mpdu1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mpdu1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MPDU1 mRNA CTD PMID:36331819 Mpdu1 Rat pirinixic acid multiple interactions ISO Mpdu1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of MPDU1 mRNA] CTD PMID:20059764 Mpdu1 Rat pirinixic acid increases expression ISO Mpdu1 (Mus musculus) 6480464 pirinixic acid results in increased expression of MPDU1 mRNA CTD PMID:18301758 more ... Mpdu1 Rat sarin decreases expression ISO MPDU1 (Homo sapiens) 6480464 Sarin results in decreased expression of MPDU1 mRNA CTD PMID:19522546 Mpdu1 Rat senecionine decreases expression ISO Mpdu1 (Mus musculus) 6480464 senecionine results in decreased expression of MPDU1 protein CTD PMID:35357534 Mpdu1 Rat sodium arsenite multiple interactions ISO MPDU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MPDU1 mRNA CTD PMID:39836092 Mpdu1 Rat sodium fluoride decreases expression ISO Mpdu1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of MPDU1 protein CTD PMID:28918527 Mpdu1 Rat sunitinib decreases expression ISO MPDU1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MPDU1 mRNA CTD PMID:31533062 Mpdu1 Rat T-2 toxin increases expression ISO MPDU1 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of MPDU1 mRNA CTD PMID:31863870 Mpdu1 Rat tamoxifen affects expression ISO Mpdu1 (Mus musculus) 6480464 Tamoxifen affects the expression of MPDU1 mRNA CTD PMID:17555576 Mpdu1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MPDU1 mRNA CTD PMID:34492290 Mpdu1 Rat titanium dioxide increases expression ISO Mpdu1 (Mus musculus) 6480464 titanium dioxide results in increased expression of MPDU1 mRNA CTD PMID:27760801 Mpdu1 Rat triptonide increases expression ISO Mpdu1 (Mus musculus) 6480464 triptonide results in increased expression of MPDU1 mRNA CTD PMID:33045310 Mpdu1 Rat urethane decreases expression ISO MPDU1 (Homo sapiens) 6480464 Urethane results in decreased expression of MPDU1 mRNA CTD PMID:28818685 Mpdu1 Rat valproic acid decreases expression ISO Mpdu1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of MPDU1 mRNA CTD PMID:21427059 Mpdu1 Rat valproic acid decreases expression ISO MPDU1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MPDU1 mRNA CTD PMID:23179753 more ... Mpdu1 Rat valproic acid affects expression ISO MPDU1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MPDU1 mRNA CTD PMID:25979313 Mpdu1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MPDU1 mRNA CTD PMID:22570695 Mpdu1 Rat zoledronic acid increases expression ISO MPDU1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of MPDU1 mRNA CTD PMID:20977926
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) carbon nanotube (ISO) chlorpyrifos (EXP,ISO) chrysene (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) entinostat (ISO) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) inulin (ISO) ivermectin (ISO) lead(0) (ISO) methidathion (ISO) ochratoxin A (ISO) paracetamol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) sarin (ISO) senecionine (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (ISO) thioacetamide (EXP) titanium dioxide (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Mpdu1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,873,467 - 54,880,536 (-) NCBI GRCr8 mRatBN7.2 10 54,374,719 - 54,380,301 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,374,725 - 54,380,447 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,037,360 - 59,042,938 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,525,912 - 58,531,490 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,033,517 - 54,039,095 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,261,636 - 56,267,213 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,261,637 - 56,267,213 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,007,275 - 56,012,851 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,474,179 - 56,480,188 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,487,803 - 56,493,840 (-) NCBI Celera 10 53,529,250 - 53,534,838 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
MPDU1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 7,583,647 - 7,588,212 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 7,583,529 - 7,592,789 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 7,486,965 - 7,491,530 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 7,427,854 - 7,432,247 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 7,427,889 - 7,432,228 NCBI Celera 17 7,513,288 - 7,517,853 (+) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 7,381,129 - 7,385,692 (+) NCBI HuRef CHM1_1 17 7,495,898 - 7,500,461 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 7,487,897 - 7,492,462 (+) NCBI T2T-CHM13v2.0
Mpdu1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 69,547,523 - 69,553,475 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 69,547,523 - 69,553,468 (-) Ensembl GRCm39 Ensembl GRCm38 11 69,656,697 - 69,662,649 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 69,656,697 - 69,662,642 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 69,470,206 - 69,476,144 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,240,811 - 70,246,749 (-) NCBI MGSCv36 mm8 MGSCv36 11 69,472,899 - 69,478,837 (-) NCBI MGSCv36 mm8 Cytogenetic Map 11 B3 NCBI cM Map 11 42.86 NCBI
Mpdu1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 9,335,488 - 9,339,874 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 9,335,488 - 9,339,888 (-) NCBI ChiLan1.0 ChiLan1.0
MPDU1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 15,178,559 - 15,182,920 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 17,144,626 - 17,149,008 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 7,615,281 - 7,619,831 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 7,601,561 - 7,606,120 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 7,601,561 - 7,610,378 (+) Ensembl panpan1.1 panPan2
MPDU1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 32,504,644 - 32,507,903 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 32,504,695 - 32,507,291 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 32,644,125 - 32,647,381 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 32,609,880 - 32,613,136 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 32,609,928 - 32,612,524 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 32,577,424 - 32,580,680 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 32,533,882 - 32,537,138 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 32,712,997 - 32,716,254 (+) NCBI UU_Cfam_GSD_1.0
Mpdu1
MPDU1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 52,878,764 - 52,882,863 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 52,878,924 - 52,882,854 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 55,291,384 - 55,295,317 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MPDU1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 6,961,117 - 6,965,991 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 6,961,310 - 6,965,424 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 14,442,794 - 14,447,292 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mpdu1
.
Predicted Target Of
Count of predictions: 168 Count of miRNA genes: 132 Interacting mature miRNAs: 143 Transcripts: ENSRNOT00000017201 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017201 ⟹ ENSRNOP00000017201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 54,374,725 - 54,380,271 (-) Ensembl Rnor_6.0 Ensembl 10 56,261,637 - 56,267,213 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103993 ⟹ ENSRNOP00000096276
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 54,374,727 - 54,380,447 (-) Ensembl
RefSeq Acc Id:
NM_001107011 ⟹ NP_001100481
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,873,473 - 54,879,049 (-) NCBI mRatBN7.2 10 54,374,725 - 54,380,301 (-) NCBI Rnor_6.0 10 56,261,637 - 56,267,213 (-) NCBI Rnor_5.0 10 56,007,275 - 56,012,851 (-) NCBI RGSC_v3.4 10 56,474,179 - 56,480,188 (-) RGD Celera 10 53,529,250 - 53,534,838 (-) RGD
Sequence:
GGCGGGGTTATCCGGACTGGCGGAAGCTACCTTTCCAACATGGCGGGCGAGACTGACGGACCGTTCAAAGGGGTGCTGGTACCAATTCTTTTACCTGAGAAATGCTATGATCAATTCTTCGTCCACTG
hide sequence
RefSeq Acc Id:
XM_017597283 ⟹ XP_017452772
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,873,467 - 54,875,349 (-) NCBI mRatBN7.2 10 54,374,719 - 54,380,301 (-) NCBI Rnor_6.0 10 56,261,636 - 56,263,507 (-) NCBI
Sequence:
GCTCCCCCAGATATTTAAACTCTTGGGAGCCAAGAGTGCAGAAGGACTGAGTCTCCAGTCAGTAATGCTGGAGCTAGTGGCACTGACTGGAACTATGGTCTACAGCATCACCAACAACTTCCCCTTCA
hide sequence
RefSeq Acc Id:
XM_063269031 ⟹ XP_063125101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,874,212 - 54,880,536 (-) NCBI
RefSeq Acc Id:
NP_001100481 ⟸ NM_001107011
- UniProtKB:
D3Z865 (UniProtKB/TrEMBL), A6HFS6 (UniProtKB/TrEMBL)
- Sequence:
MAGETDGPFKGVLVPILLPEKCYDQFFVHWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQIFKLLGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLTLQTVTICFLVMHYRGETV
hide sequence
RefSeq Acc Id:
XP_017452772 ⟸ XM_017597283
- Peptide Label:
isoform X2
- Sequence:
MHYRGETVKGVAFLVCFAVVLLALLSPVMPLAVPTLLQASNVPAVVVGKLLQAATNYHNGHTGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAPHKQKKQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000017201 ⟸ ENSRNOT00000017201
Ensembl Acc Id:
ENSRNOP00000096276 ⟸ ENSRNOT00000103993
RefSeq Acc Id:
XP_063125101 ⟸ XM_063269031
- Peptide Label:
isoform X1
RGD ID: 13697319 Promoter ID: EPDNEW_R7844 Type: multiple initiation site Name: Mpdu1_1 Description: mannose-P-dolichol utilization defect 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 56,267,183 - 56,267,243 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Mpdu1
mannose-P-dolichol utilization defect 1
Mpdu1_predicted
mannose-P-dolichol utilization defect 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Mpdu1_predicted
mannose-P-dolichol utilization defect 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
