Symbol:
Marveld2
Name:
MARVEL domain containing 2
RGD ID:
1306909
Description:
Predicted to be involved in bicellular tight junction assembly and establishment of endothelial barrier. Predicted to act upstream of or within cell-cell junction organization and sensory perception of sound. Predicted to be located in several cellular components, including Schmidt-Lanterman incisure; basolateral plasma membrane; and tight junction. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 49. Orthologous to human MARVELD2 (MARVEL domain containing 2); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC365657; MARVEL (membrane-associating) domain containing 2; MARVEL domain-containing protein 2; Mrvldc2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 33,474,750 - 33,498,225 (-) NCBI GRCr8 mRatBN7.2 2 31,742,652 - 31,764,150 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 31,657,220 - 31,764,150 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 38,877,135 - 38,898,580 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 36,917,467 - 36,939,000 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 31,775,299 - 31,796,859 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 30,612,746 - 30,634,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 30,612,106 - 30,634,243 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 49,772,500 - 49,793,880 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 31,403,014 - 31,424,394 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 31,322,975 - 31,340,096 (-) NCBI Celera 2 27,755,610 - 27,776,847 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Marveld2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 33,474,750 - 33,498,225 (-) NCBI GRCr8 mRatBN7.2 2 31,742,652 - 31,764,150 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 31,657,220 - 31,764,150 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 38,877,135 - 38,898,580 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 36,917,467 - 36,939,000 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 31,775,299 - 31,796,859 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 30,612,746 - 30,634,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 30,612,106 - 30,634,243 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 49,772,500 - 49,793,880 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 31,403,014 - 31,424,394 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 31,322,975 - 31,340,096 (-) NCBI Celera 2 27,755,610 - 27,776,847 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
MARVELD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 69,415,116 - 69,444,330 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 69,415,065 - 69,444,330 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 68,710,943 - 68,740,157 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 68,746,699 - 68,775,592 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 68,746,698 - 68,775,592 NCBI Celera 5 65,713,884 - 65,740,393 (+) NCBI Celera Cytogenetic Map 5 q13.2 NCBI HuRef 5 65,667,182 - 65,694,144 (+) NCBI HuRef CHM1_1 5 68,710,674 - 68,737,631 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 70,241,108 - 70,269,905 (+) NCBI T2T-CHM13v2.0
Marveld2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 100,732,465 - 100,753,479 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 100,732,465 - 100,753,479 (-) Ensembl GRCm39 Ensembl GRCm38 13 100,595,957 - 100,616,971 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 100,595,957 - 100,616,971 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 101,365,912 - 101,386,926 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 101,696,216 - 101,717,205 (-) NCBI MGSCv36 mm8 Celera 13 104,205,959 - 104,226,958 (-) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 53.23 NCBI
Marveld2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955575 115,752 - 139,463 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955575 115,734 - 135,568 (+) NCBI ChiLan1.0 ChiLan1.0
MARVELD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 44,475,078 - 44,504,237 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 42,627,667 - 42,658,071 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 44,557,385 - 44,585,868 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 46,128,408 - 46,155,981 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 46,128,408 - 46,155,981 (-) Ensembl panpan1.1 panPan2
MARVELD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 54,438,046 - 54,458,890 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 54,441,797 - 54,457,515 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 51,404,391 - 51,425,210 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 54,949,876 - 54,970,675 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 54,953,611 - 54,969,301 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 52,014,157 - 52,034,938 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 52,780,960 - 52,801,785 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 53,671,348 - 53,692,186 (+) NCBI UU_Cfam_GSD_1.0
Marveld2
MARVELD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 47,530,068 - 47,563,482 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 47,529,857 - 47,563,485 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 51,405,308 - 51,423,813 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 16 51,499,084 - 51,505,697 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MARVELD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 65,501,979 - 65,532,345 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 65,506,474 - 65,535,566 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 14,238,514 - 14,269,609 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Marveld2
.
Predicted Target Of
Count of predictions: 21 Count of miRNA genes: 21 Interacting mature miRNAs: 21 Transcripts: ENSRNOT00000024700 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
BE101406
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 31,742,170 - 31,742,330 (+) MAPPER mRatBN7.2 Rnor_6.0 2 30,612,265 - 30,612,424 NCBI Rnor6.0 Rnor_5.0 2 49,772,018 - 49,772,177 UniSTS Rnor5.0 RGSC_v3.4 2 31,402,532 - 31,402,691 UniSTS RGSC3.4 Celera 2 27,755,128 - 27,755,287 UniSTS RH 3.4 Map 2 62.9 UniSTS Cytogenetic Map 2 q12 UniSTS
AU046613
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 31,750,842 - 31,751,014 (+) MAPPER mRatBN7.2 Rnor_6.0 2 30,620,937 - 30,621,108 NCBI Rnor6.0 Rnor_5.0 2 49,780,574 - 49,780,745 UniSTS Rnor5.0 RGSC_v3.4 2 31,411,088 - 31,411,259 UniSTS RGSC3.4 Celera 2 27,763,839 - 27,764,000 UniSTS Cytogenetic Map 2 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024674 ⟹ ENSRNOP00000024674
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,657,220 - 31,707,120 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077537 ⟹ ENSRNOP00000070680
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,742,653 - 31,759,468 (-) Ensembl Rnor_6.0 Ensembl 2 30,612,747 - 30,634,243 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084667 ⟹ ENSRNOP00000068691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,657,220 - 31,760,321 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085488 ⟹ ENSRNOP00000073691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,725,984 - 31,764,150 (-) Ensembl Rnor_6.0 Ensembl 2 30,612,106 - 30,633,857 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106737 ⟹ ENSRNOP00000078336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,742,653 - 31,764,002 (-) Ensembl
RefSeq Acc Id:
NM_001108936 ⟹ NP_001102406
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 33,476,729 - 33,498,225 (-) NCBI mRatBN7.2 2 31,742,653 - 31,764,150 (-) NCBI Rnor_6.0 2 30,612,747 - 30,634,243 (-) NCBI Rnor_5.0 2 49,772,500 - 49,793,880 (-) NCBI RGSC_v3.4 2 31,403,014 - 31,424,394 (-) RGD Celera 2 27,755,610 - 27,776,847 (-) RGD
Sequence:
GTGCTTGCTTCCTGGCCAGAGCTCCGCAGCCCGCCGGGCTGGCGGGCGGGGCGCTGGGACCGGGTCACGCCCCAGGAGCTCGATCCCAGTTTCGGTGCCCGCGGGAACGCGTGCTCTTCCGGCGGCCG
hide sequence
RefSeq Acc Id:
XM_008760679 ⟹ XP_008758901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 33,474,750 - 33,498,118 (-) NCBI mRatBN7.2 2 31,742,652 - 31,764,011 (-) NCBI Rnor_6.0 2 30,612,746 - 30,633,894 (-) NCBI
Sequence:
GCCCTCGCCACTTTCCCGGCTGGCCTGCCGGGGACGACAGCCACCTTAGGGCGGAAGCCCGAGT
hide sequence
RefSeq Acc Id:
XM_008760680 ⟹ XP_008758902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 33,474,750 - 33,498,220 (-) NCBI mRatBN7.2 2 31,742,652 - 31,764,120 (-) NCBI Rnor_6.0 2 30,612,746 - 30,634,308 (-) NCBI
Sequence:
GCCTTGGGTGCAGGCATAAGTAGAGCAAATGCTCTAAAATGGGAAGGCCAGGTAGCACCTATGC
hide sequence
RefSeq Acc Id:
XM_008760681 ⟹ XP_008758903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 33,474,750 - 33,497,782 (-) NCBI mRatBN7.2 2 31,742,652 - 31,763,675 (-) NCBI Rnor_6.0 2 30,612,746 - 30,633,783 (-) NCBI
Sequence:
ATGGTCGCGCTGCTGGGAGGCTAGATGTGGGAGCCTGGCGGGAATGATGGTTGTCGGTCCTCTC
hide sequence
RefSeq Acc Id:
NP_001102406 ⟸ NM_001108936
- UniProtKB:
A0A0G2JYJ6 (UniProtKB/TrEMBL), A6I595 (UniProtKB/TrEMBL), A0A0G2K663 (UniProtKB/TrEMBL)
- Sequence:
MSSSDGRSRIRDRDYSEVPRDSPCPDGIVRTLQSLHSSELAVSADPLPPPPLPLQPPFGPSFYSGDTEEPAVAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHH
hide sequence
RefSeq Acc Id:
XP_008758902 ⟸ XM_008760680
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K663 (UniProtKB/TrEMBL)
- Sequence:
MSSSDGRSRIRDRDYSEVPRDSPCPDGIVRTLQSLHSSELAVSADPLPPPPLPLQPPFGPSFYS
hide sequence
RefSeq Acc Id:
XP_008758901 ⟸ XM_008760679
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K663 (UniProtKB/TrEMBL)
- Sequence:
MSSSDGRSRIRDRDYSEVPRDSPCPDGIVRTLQSLHSSELAVSADPLPPPPLPLQPPFGPSFYSGDTEEPAVAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHH
hide sequence
RefSeq Acc Id:
XP_008758903 ⟸ XM_008760681
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K663 (UniProtKB/TrEMBL)
- Sequence:
MSSSDGRSRIRDRDYSEVPRDSPCPDGIVRTLQSLHSSELAVSADPLPPPPLPLQPPFGPSFYS
hide sequence
Ensembl Acc Id:
ENSRNOP00000073691 ⟸ ENSRNOT00000085488
Ensembl Acc Id:
ENSRNOP00000070680 ⟸ ENSRNOT00000077537
Ensembl Acc Id:
ENSRNOP00000024674 ⟸ ENSRNOT00000024674
Ensembl Acc Id:
ENSRNOP00000068691 ⟸ ENSRNOT00000084667
Ensembl Acc Id:
ENSRNOP00000078336 ⟸ ENSRNOT00000106737
RGD ID: 13691109 Promoter ID: EPDNEW_R1630 Type: single initiation site Name: Marveld2_1 Description: MARVEL domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 30,633,888 - 30,633,948 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-24
Marveld2
MARVEL domain containing 2
Marveld2
MARVEL (membrane-associating) domain containing 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Marveld2
MARVEL (membrane-associating) domain containing 2
Marveld2_predicted
MARVEL (membrane-associating) domain containing 2 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Marveld2_predicted
MARVEL (membrane-associating) domain containing 2 (predicted)
Mrvldc2_predicted
Symbol updated
1299863 APPROVED
2005-01-12
Mrvldc2_predicted
MARVEL (membrane-associating) domain containing 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
