Symbol:
Rev1
Name:
REV1, DNA directed polymerase
RGD ID:
1306715
Description:
Predicted to enable DNA-directed DNA polymerase activity and deoxycytidyl transferase activity. Predicted to be involved in error-free translesion synthesis; error-prone translesion synthesis; and response to UV. Predicted to be located in nucleus. Orthologous to human REV1 (REV1 DNA directed polymerase); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DNA repair protein REV1; LOC316344; REV1 homolog; REV1 homolog (S. cerevisiae); REV1, polymerase (DNA directed); REV1-like; REV1-like (S. cerevisiae); Rev1l
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
REV1 (REV1 DNA directed polymerase) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Rev1 (REV1, DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rev1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
REV1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
REV1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rev1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
REV1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rev1 (REV1 DNA directed polymerase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC29A2 (solute carrier family 29 member 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
REV1 (REV1 DNA directed polymerase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rev1 (REV1, DNA directed polymerase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rev1 (REV1 DNA directed polymerase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
REV1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rev1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rev-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rev1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 47,773,907 - 47,847,554 (-) NCBI GRCr8 mRatBN7.2 9 40,278,100 - 40,351,764 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 40,278,101 - 40,351,576 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 48,773,815 - 48,846,572 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 53,896,577 - 53,969,330 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 52,178,823 - 52,252,241 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 44,714,137 - 44,786,330 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 44,714,386 - 44,786,041 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 44,410,205 - 44,481,659 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 36,994,269 - 37,042,663 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 36,995,974 - 37,069,555 (-) NCBI Celera 9 38,030,447 - 38,078,175 (-) NCBI Celera Cytogenetic Map 9 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rev1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of REV1 mRNA] CTD PMID:31150632 Rev1 Rat (-)-demecolcine decreases expression ISO REV1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of REV1 mRNA CTD PMID:23649840 Rev1 Rat 1,2-dimethylhydrazine decreases expression ISO Rev1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of REV1 mRNA CTD PMID:22206623 Rev1 Rat 17alpha-ethynylestradiol multiple interactions ISO Rev1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of REV1 mRNA CTD PMID:17942748 Rev1 Rat 17beta-estradiol decreases expression ISO Rev1 (Mus musculus) 6480464 Estradiol results in decreased expression of REV1 mRNA CTD PMID:39298647 Rev1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of REV1 mRNA CTD PMID:35192832 Rev1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rev1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of REV1 mRNA CTD PMID:17942748 Rev1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of REV1 mRNA CTD PMID:33387578 Rev1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rev1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of REV1 mRNA CTD PMID:21570461 Rev1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rev1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of REV1 mRNA CTD PMID:21354282 and PMID:28922406 Rev1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of REV1 mRNA CTD PMID:19162173 Rev1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Rev1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of REV1 mRNA CTD PMID:18648102 Rev1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rev1 (Mus musculus) 6480464 bisphenol S results in decreased expression of REV1 mRNA CTD PMID:39298647 Rev1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO REV1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of REV1 gene CTD PMID:31601247 Rev1 Rat 4-hydroxynon-2-enal multiple interactions ISO Rev1 (Mus musculus) 6480464 REV1 protein affects the reaction [4-hydroxy-2-nonenal results in increased phosphorylation of H2AX protein] CTD PMID:22331492 Rev1 Rat 4-hydroxynon-2-enal affects response to substance ISO Rev1 (Mus musculus) 6480464 REV1 protein affects the susceptibility to 4-hydroxy-2-nonenal CTD PMID:22331492 Rev1 Rat 5-fluorouracil affects expression ISO REV1 (Homo sapiens) 6480464 Fluorouracil affects the expression of REV1 mRNA CTD PMID:16584549 Rev1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of REV1 mRNA CTD PMID:28959563 Rev1 Rat aflatoxin B1 increases expression ISO Rev1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of REV1 mRNA CTD PMID:19770486 Rev1 Rat aflatoxin B1 decreases methylation ISO REV1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of REV1 gene CTD PMID:27153756 Rev1 Rat antirheumatic drug increases expression ISO REV1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of REV1 mRNA CTD PMID:24449571 Rev1 Rat aristolochic acid A decreases expression ISO REV1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of REV1 mRNA CTD PMID:33212167 Rev1 Rat arsane multiple interactions ISO REV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of REV1 mRNA CTD PMID:39836092 Rev1 Rat arsenic atom multiple interactions ISO REV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of REV1 mRNA CTD PMID:39836092 Rev1 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of REV1 mRNA CTD PMID:33854195 Rev1 Rat belinostat decreases expression ISO Rev1 (Mus musculus) 6480464 belinostat results in decreased expression of REV1 mRNA CTD PMID:29733868 Rev1 Rat benzo[a]pyrene increases expression ISO Rev1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of REV1 mRNA CTD PMID:19770486 Rev1 Rat benzo[a]pyrene multiple interactions ISO Rev1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of REV1 mRNA CTD PMID:27858113 Rev1 Rat benzo[a]pyrene diol epoxide I multiple interactions ISO Rev1 (Mus musculus) 6480464 REV1 protein affects the reaction [7 more ... CTD PMID:22331492 Rev1 Rat benzo[a]pyrene diol epoxide I affects response to substance ISO Rev1 (Mus musculus) 6480464 REV1 protein affects the susceptibility to 7 more ... CTD PMID:22331492 Rev1 Rat benzo[b]fluoranthene increases expression ISO Rev1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of REV1 mRNA CTD PMID:26377693 Rev1 Rat benzo[b]fluoranthene multiple interactions ISO Rev1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of REV1 mRNA CTD PMID:27858113 Rev1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of REV1 mRNA CTD PMID:25181051 and PMID:30816183 Rev1 Rat bisphenol A increases expression ISO Rev1 (Mus musculus) 6480464 bisphenol A results in increased expression of REV1 mRNA CTD PMID:35598803 Rev1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of REV1 gene CTD PMID:28505145 Rev1 Rat Bisphenol A diglycidyl ether affects splicing ISO Rev1 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of REV1 mRNA CTD PMID:36464114 Rev1 Rat bisphenol AF affects splicing ISO Rev1 (Mus musculus) 6480464 bisphenol AF affects the splicing of REV1 mRNA CTD PMID:36464114 Rev1 Rat bisphenol F decreases expression ISO Rev1 (Mus musculus) 6480464 bisphenol F results in decreased expression of REV1 mRNA CTD PMID:38685157 Rev1 Rat butanal decreases expression ISO REV1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of REV1 mRNA CTD PMID:26079696 Rev1 Rat cadmium dichloride decreases expression ISO REV1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of REV1 mRNA CTD PMID:38568856 Rev1 Rat caffeine increases phosphorylation ISO REV1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of REV1 protein CTD PMID:35688186 Rev1 Rat carbon nanotube decreases expression ISO Rev1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of REV1 mRNA CTD PMID:25554681 Rev1 Rat chloroprene increases expression ISO Rev1 (Mus musculus) 6480464 Chloroprene results in increased expression of REV1 mRNA CTD PMID:23125180 Rev1 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of REV1 mRNA CTD PMID:33854195 Rev1 Rat chrysene multiple interactions ISO Rev1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of REV1 mRNA CTD PMID:27858113 Rev1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of REV1 mRNA CTD PMID:30556269 Rev1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of REV1 mRNA CTD PMID:30556269 Rev1 Rat cyclophosphamide decreases response to substance ISO Rev1 (Mus musculus) 6480464 REV1 protein results in decreased susceptibility to Cyclophosphamide CTD PMID:21068378 Rev1 Rat cyclosporin A increases methylation ISO REV1 (Homo sapiens) 6480464 Cyclosporine results in increased methylation of REV1 promoter CTD PMID:27989131 Rev1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of REV1 mRNA CTD PMID:23640034 Rev1 Rat Dibutyl phosphate affects expression ISO REV1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of REV1 mRNA CTD PMID:37042841 Rev1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of REV1 mRNA CTD PMID:21266533 Rev1 Rat dicrotophos decreases expression ISO REV1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of REV1 mRNA CTD PMID:28302478 Rev1 Rat dioxygen multiple interactions ISO Rev1 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of REV1 mRNA CTD PMID:30529165 Rev1 Rat dorsomorphin multiple interactions ISO REV1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REV1 mRNA CTD PMID:27188386 Rev1 Rat doxorubicin multiple interactions ISO REV1 (Homo sapiens) 6480464 [TP53 protein affects the susceptibility to Doxorubicin] which affects the expression of REV1 mRNA CTD PMID:36634904 Rev1 Rat doxorubicin decreases expression ISO REV1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of REV1 mRNA CTD PMID:36634904 Rev1 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of REV1 mRNA CTD PMID:17347304 Rev1 Rat folic acid decreases expression ISO Rev1 (Mus musculus) 6480464 Folic Acid results in decreased expression of REV1 mRNA CTD PMID:25629700 Rev1 Rat formaldehyde decreases expression ISO REV1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of REV1 mRNA CTD PMID:20655997 Rev1 Rat FR900359 decreases phosphorylation ISO REV1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of REV1 protein CTD PMID:37730182 Rev1 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of REV1 mRNA CTD PMID:33854195 Rev1 Rat guanine decreases activity ISO REV1 (Homo sapiens) 6480464 Guanine metabolite results in decreased activity of REV1 protein CTD PMID:26010525 Rev1 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of REV1 mRNA CTD PMID:33854195 Rev1 Rat indometacin decreases expression ISO REV1 (Homo sapiens) 6480464 Indomethacin results in decreased expression of REV1 mRNA CTD PMID:16984733 Rev1 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of REV1 mRNA CTD PMID:20080153 Rev1 Rat methyl methanesulfonate increases expression ISO REV1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of REV1 mRNA CTD PMID:23649840 Rev1 Rat methylmercury chloride decreases expression ISO REV1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of REV1 mRNA CTD PMID:28001369 Rev1 Rat myristicin decreases expression ISO REV1 (Homo sapiens) 6480464 myristicin results in decreased expression of REV1 mRNA CTD PMID:24792648 Rev1 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of REV1 mRNA CTD PMID:23358140 Rev1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of REV1 mRNA CTD PMID:33387578 Rev1 Rat phenobarbital increases expression ISO Rev1 (Mus musculus) 6480464 Phenobarbital results in increased expression of REV1 mRNA CTD PMID:19270015 Rev1 Rat phenylmercury acetate increases expression ISO REV1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of REV1 mRNA CTD PMID:26272509 Rev1 Rat phenylmercury acetate multiple interactions ISO REV1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REV1 mRNA CTD PMID:27188386 Rev1 Rat pirinixic acid increases expression ISO Rev1 (Mus musculus) 6480464 pirinixic acid results in increased expression of REV1 mRNA CTD PMID:17426115 Rev1 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of REV1 mRNA CTD PMID:33775663 Rev1 Rat resveratrol multiple interactions ISO REV1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of REV1 mRNA CTD PMID:23557933 Rev1 Rat SB 431542 multiple interactions ISO REV1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REV1 mRNA CTD PMID:27188386 Rev1 Rat sodium arsenite increases expression ISO REV1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of REV1 mRNA CTD PMID:17879257 Rev1 Rat sodium arsenite multiple interactions ISO REV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of REV1 mRNA CTD PMID:39836092 Rev1 Rat sulforaphane multiple interactions ISO Rev1 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of REV1 mRNA CTD PMID:30529165 Rev1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of REV1 mRNA CTD PMID:31150632 Rev1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of REV1 mRNA] CTD PMID:31150632 Rev1 Rat tetraphene multiple interactions ISO Rev1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of REV1 mRNA CTD PMID:27858113 Rev1 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of REV1 mRNA CTD PMID:33854195 Rev1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of REV1 mRNA CTD PMID:34492290 Rev1 Rat titanium dioxide decreases methylation ISO Rev1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of REV1 promoter CTD PMID:35295148 Rev1 Rat titanium dioxide increases methylation ISO Rev1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of REV1 gene CTD PMID:35295148 Rev1 Rat trichostatin A affects expression ISO REV1 (Homo sapiens) 6480464 trichostatin A affects the expression of REV1 mRNA CTD PMID:28542535 Rev1 Rat troglitazone decreases expression ISO Rev1 (Mus musculus) 6480464 troglitazone results in decreased expression of REV1 mRNA CTD PMID:28973697 Rev1 Rat urethane decreases expression ISO REV1 (Homo sapiens) 6480464 Urethane results in decreased expression of REV1 mRNA CTD PMID:28818685 Rev1 Rat valproic acid decreases methylation ISO REV1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of REV1 gene CTD PMID:29154799 Rev1 Rat valproic acid affects expression ISO REV1 (Homo sapiens) 6480464 Valproic Acid affects the expression of REV1 mRNA CTD PMID:25979313 Rev1 Rat valproic acid decreases expression ISO REV1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of REV1 mRNA CTD PMID:23179753 Rev1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of REV1 mRNA CTD PMID:23034163 Rev1 Rat vincristine decreases expression ISO REV1 (Homo sapiens) 6480464 Vincristine results in decreased expression of REV1 mRNA CTD PMID:23649840 Rev1 Rat vorinostat decreases expression ISO Rev1 (Mus musculus) 6480464 Vorinostat results in decreased expression of REV1 mRNA CTD PMID:32512035
(+)-schisandrin B (EXP) (-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-fluorouracil (ISO) acrylamide (EXP) aflatoxin B1 (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) azoxystrobin (EXP) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chloroprene (ISO) chlorpyrifos (EXP) chrysene (ISO) copper atom (EXP) copper(0) (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) decabromodiphenyl ether (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) glyphosate (EXP) guanine (ISO) imidacloprid (EXP) indometacin (ISO) ketamine (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) myristicin (ISO) ochratoxin A (EXP) paracetamol (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) resveratrol (EXP,ISO) SB 431542 (ISO) sodium arsenite (ISO) sulforaphane (ISO) tetrachloromethane (EXP) tetraphene (ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) vorinostat (ISO)
Rev1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 47,773,907 - 47,847,554 (-) NCBI GRCr8 mRatBN7.2 9 40,278,100 - 40,351,764 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 40,278,101 - 40,351,576 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 48,773,815 - 48,846,572 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 53,896,577 - 53,969,330 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 52,178,823 - 52,252,241 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 44,714,137 - 44,786,330 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 44,714,386 - 44,786,041 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 44,410,205 - 44,481,659 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 36,994,269 - 37,042,663 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 36,995,974 - 37,069,555 (-) NCBI Celera 9 38,030,447 - 38,078,175 (-) NCBI Celera Cytogenetic Map 9 q21 NCBI
REV1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 99,400,477 - 99,490,202 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 99,400,475 - 99,490,035 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 100,016,940 - 100,106,479 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 99,383,370 - 99,472,912 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 99,475,931 - 99,564,998 NCBI Celera 2 94,221,622 - 94,311,168 (-) NCBI Celera Cytogenetic Map 2 q11.2 NCBI HuRef 2 93,782,782 - 93,847,070 (-) NCBI HuRef CHM1_1 2 100,021,704 - 100,109,885 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 99,859,127 - 99,948,858 (-) NCBI T2T-CHM13v2.0
Rev1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 38,091,867 - 38,169,191 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 38,091,867 - 38,168,882 (-) Ensembl GRCm39 Ensembl GRCm38 1 38,052,786 - 38,129,921 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 38,052,786 - 38,129,801 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 38,109,631 - 38,186,507 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 37,997,332 - 38,074,208 (-) NCBI MGSCv36 mm8 Celera 1 37,830,205 - 37,907,067 (-) NCBI Celera Cytogenetic Map 1 B NCBI cM Map 1 16.46 NCBI
Rev1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955470 5,677,222 - 5,738,362 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955470 5,677,222 - 5,738,362 (-) NCBI ChiLan1.0 ChiLan1.0
REV1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 28,941,164 - 29,030,665 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 28,943,931 - 29,033,425 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 99,808,519 - 99,897,989 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 100,329,475 - 100,418,684 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 100,329,475 - 100,418,678 (-) Ensembl panpan1.1 panPan2
REV1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 43,150,885 - 43,247,324 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 42,586,394 - 43,247,328 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 43,074,777 - 43,171,213 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 44,020,399 - 44,116,914 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 44,020,389 - 44,116,904 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 43,733,744 - 43,830,134 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 44,016,125 - 44,112,521 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 44,198,477 - 44,294,929 (+) NCBI UU_Cfam_GSD_1.0
Rev1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 85,171,516 - 85,246,570 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936661 1,333,577 - 1,398,227 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936661 1,322,907 - 1,397,990 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
REV1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 3,128,824 - 3,218,894 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 3,129,529 - 3,218,866 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 170,730,018 - 170,820,108 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rev1
.
Predicted Target Of
Count of predictions: 403 Count of miRNA genes: 236 Interacting mature miRNAs: 283 Transcripts: ENSRNOT00000067197 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 7207805 Bmd88 Bone mineral density QTL 88 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 9 23754024 58157242 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 724543 Cm20 Cardiac mass QTL 20 3.9 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 16961398 40594091 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 1598823 Memor16 Memory QTL 16 1.9 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 22133322 49968732 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
BF389054
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 40,279,215 - 40,279,349 (+) MAPPER mRatBN7.2 Rnor_6.0 9 44,715,252 - 44,715,385 NCBI Rnor6.0 Rnor_5.0 9 44,411,321 - 44,411,454 UniSTS Rnor5.0 RGSC_v3.4 9 36,995,384 - 36,995,517 UniSTS RGSC3.4 Celera 9 38,031,562 - 38,031,695 UniSTS RH 3.4 Map 9 371.6 UniSTS Cytogenetic Map 9 q21 UniSTS
BF403627
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 40,399,302 - 40,399,481 (+) MAPPER mRatBN7.2 Rnor_6.0 9 44,834,959 - 44,835,137 NCBI Rnor6.0 Rnor_5.0 9 44,530,584 - 44,530,762 UniSTS Rnor5.0 RGSC_v3.4 9 37,116,258 - 37,116,436 UniSTS RGSC3.4 Celera 9 38,151,544 - 38,151,722 UniSTS RH 3.4 Map 9 375.8 UniSTS Cytogenetic Map 9 q21 UniSTS
BF403788
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 40,307,125 - 40,307,276 (+) MAPPER mRatBN7.2 Rnor_6.0 9 44,743,162 - 44,743,312 NCBI Rnor6.0 Rnor_5.0 9 44,439,231 - 44,439,381 UniSTS Rnor5.0 RGSC_v3.4 9 37,023,294 - 37,023,444 UniSTS RGSC3.4 Celera 9 38,059,472 - 38,059,622 UniSTS RH 3.4 Map 9 379.6 UniSTS Cytogenetic Map 9 q21 UniSTS
RH140965
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 40,402,397 - 40,402,582 (+) MAPPER mRatBN7.2 Rnor_6.0 9 44,838,054 - 44,838,238 NCBI Rnor6.0 Rnor_5.0 9 44,533,679 - 44,533,863 UniSTS Rnor5.0 RGSC_v3.4 9 37,119,353 - 37,119,537 UniSTS RGSC3.4 Celera 9 38,154,639 - 38,154,823 UniSTS RH 3.4 Map 9 373.3 UniSTS Cytogenetic Map 9 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067197 ⟹ ENSRNOP00000059807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 40,278,105 - 40,351,388 (-) Ensembl Rnor_6.0 Ensembl 9 44,714,386 - 44,786,041 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111097 ⟹ ENSRNOP00000076682
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 40,278,101 - 40,351,576 (-) Ensembl
RefSeq Acc Id:
NM_001394129 ⟹ NP_001381058
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,327 (-) NCBI mRatBN7.2 9 40,278,100 - 40,351,520 (-) NCBI
RefSeq Acc Id:
NR_172081
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,821,636 (-) NCBI mRatBN7.2 9 40,278,100 - 40,325,829 (-) NCBI
RefSeq Acc Id:
XM_008767030 ⟹ XP_008765252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,806,596 (-) NCBI mRatBN7.2 9 40,278,100 - 40,310,789 (-) NCBI Rnor_6.0 9 44,714,138 - 44,746,988 (-) NCBI
Sequence:
AAGAGTCTCAACTTCACTCCTGTGTGCAAGCCTGAGGAGCCTGTACCAGGTCCAAGCGAGATAGCCAAACAGCTCACCAACAGGGTGTAAGTGTGTACATTGGAAAGCCCACAGTATAGCCAAACAGT
hide sequence
RefSeq Acc Id:
XM_017596444 ⟹ XP_017451933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,796,978 (-) NCBI mRatBN7.2 9 40,278,100 - 40,301,170 (-) NCBI Rnor_6.0 9 44,714,138 - 44,739,588 (-) NCBI
Sequence:
ATGACTTCTTTGAAGCCATAGTGCTCCCATGGATGGCCTCTGGATGTTGCTAGTGGTGTCGGTGCTGTAGGAGGAAAAGTAGAATTAGAATAATTAGCTCTTTACAGTTGAAGGCCTTGGATGCTAAT
hide sequence
RefSeq Acc Id:
XM_017596445 ⟹ XP_017451934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,796,978 (-) NCBI mRatBN7.2 9 40,278,100 - 40,301,170 (-) NCBI Rnor_6.0 9 44,714,138 - 44,739,588 (-) NCBI
Sequence:
ATGACTTCTTTGAAGCCATAGTGCTCCCATGGATGGCCTCTGGATGTTGCTAGTGGTGTCGGTG
hide sequence
RefSeq Acc Id:
XM_017596446 ⟹ XP_017451935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,790,753 (-) NCBI mRatBN7.2 9 40,278,100 - 40,294,946 (-) NCBI Rnor_6.0 9 44,714,138 - 44,733,769 (-) NCBI
Sequence:
GCTAGGCAAGCGCTCTACCACTGAGCTAAATCCCCAACCCCTATTCTTAGCCATTTTATATATC
hide sequence
RefSeq Acc Id:
XM_039083576 ⟹ XP_038939504
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,191 (-) NCBI mRatBN7.2 9 40,278,100 - 40,351,453 (-) NCBI
RefSeq Acc Id:
XM_039083577 ⟹ XP_038939505
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,554 (-) NCBI mRatBN7.2 9 40,278,100 - 40,351,764 (-) NCBI
RefSeq Acc Id:
XM_039083578 ⟹ XP_038939506
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,463 (-) NCBI mRatBN7.2 9 40,278,100 - 40,351,764 (-) NCBI
RefSeq Acc Id:
XM_039083579 ⟹ XP_038939507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,845,827 (-) NCBI mRatBN7.2 9 40,278,100 - 40,350,020 (-) NCBI
RefSeq Acc Id:
XM_039083580 ⟹ XP_038939508
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,845,214 (-) NCBI mRatBN7.2 9 40,278,100 - 40,349,407 (-) NCBI
RefSeq Acc Id:
XM_063267158 ⟹ XP_063123228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,845,927 (-) NCBI
RefSeq Acc Id:
XM_063267159 ⟹ XP_063123229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,187 (-) NCBI
RefSeq Acc Id:
XM_063267160 ⟹ XP_063123230
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,187 (-) NCBI
RefSeq Acc Id:
XM_063267161 ⟹ XP_063123231
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,773,907 - 47,847,463 (-) NCBI
RefSeq Acc Id:
XR_010054595
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 47,778,309 - 47,847,187 (-) NCBI
RefSeq Acc Id:
XP_008765252 ⟸ XM_008767030
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZJ91 (UniProtKB/TrEMBL)
- Sequence:
MHPRDTAVIFNGHAHSSNGALKTQDCLVPVDHSVASRLSLDSTQEEKRAEKSSTDFRDCSRQHLQHSTTNADTLCSPHRTSSLSPSLHSNTKINGAHHSTVQGPSSTKSTSALTLSKVAPSVPSKPSD
hide sequence
RefSeq Acc Id:
XP_017451934 ⟸ XM_017596445
- Peptide Label:
isoform X6
- Sequence:
MFFGHAKQLCPNLQAVPYDFHACREVAQALYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRMEIKNKTQCAASVGIGSNILLARMATKKAKPDGQYHLQPDEVDDFIRGQLVTSLPG
hide sequence
RefSeq Acc Id:
XP_017451933 ⟸ XM_017596444
- Peptide Label:
isoform X6
- Sequence:
MFFGHAKQLCPNLQAVPYDFHACREVAQALYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRMEIKNKTQCAASVGIGSNILLARMATKKAKPDGQYHLQPDEVDDFIRGQLVTSLPG
hide sequence
RefSeq Acc Id:
XP_017451935 ⟸ XM_017596446
- Peptide Label:
isoform X6
- Sequence:
MFFGHAKQLCPNLQAVPYDFHACREVAQALYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRMEIKNKTQCAASVGIGSNILLARMATKKAKPDGQYHLQPDEVDDFIRGQLVTSLPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000059807 ⟸ ENSRNOT00000067197
RefSeq Acc Id:
XP_038939506 ⟸ XM_039083578
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038939505 ⟸ XM_039083577
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038939504 ⟸ XM_039083576
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038939507 ⟸ XM_039083579
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038939508 ⟸ XM_039083580
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000076682 ⟸ ENSRNOT00000111097
RefSeq Acc Id:
NP_001381058 ⟸ NM_001394129
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123231 ⟸ XM_063267161
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123230 ⟸ XM_063267160
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123229 ⟸ XM_063267159
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZJ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123228 ⟸ XM_063267158
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRU9 (UniProtKB/TrEMBL), A0A8I5ZJ91 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-13
Rev1
REV1, DNA directed polymerase
Rev1
REV1, polymerase (DNA directed)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-10
Rev1
REV1, polymerase (DNA directed)
Rev1
REV1 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Rev1
REV1 homolog (S. cerevisiae)
Rev1l_predicted
REV1-like (S. cerevisiae) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Rev1l_predicted
REV1-like (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
