Advanced Search (OLGA)

Gene: Spaca3 (sperm acrosome associated 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Spaca3

Name:

sperm acrosome associated 3

RGD ID:

1306684

Description:

Predicted to be involved in fusion of sperm to egg plasma membrane involved in single fertilization. Predicted to act upstream of or within sperm-egg recognition. Predicted to be located in acrosomal matrix and acrosomal membrane. Predicted to be active in acrosomal vesicle and sperm flagellum. Orthologous to human SPACA3 (sperm acrosome associated 3); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC287557; lysozyme c; Lyzc; sperm acrosome membrane-associated protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPACA3 (sperm acrosome associated 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Spaca3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spaca3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPACA3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPACA3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spaca3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPACA3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPACA3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spaca3 (sperm acrosome associated 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	POPDC2 (popeye domain cAMP effector 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SPACA3 (sperm acrosome associated 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spaca3 (sperm acrosome associated 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lyz (lysozyme)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11159	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16756	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16799	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	66,348,336 - 66,355,808 (+)	NCBI		GRCr8
mRatBN7.2	10	65,850,618 - 65,858,090 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	65,854,893 - 65,858,094 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	70,478,623 - 70,486,095 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	69,983,949 - 69,991,421 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	65,445,229 - 65,452,710 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	68,227,736 - 68,235,295 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	68,232,094 - 68,235,295 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	67,895,784 - 67,903,343 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	69,083,140 - 69,090,699 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	69,096,841 - 69,104,318 (+)	NCBI
Celera	10	64,808,885 - 64,816,434 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spaca3	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:28712647
Spaca3	Rat	benzo[a]pyrene	increases methylation	ISO	SPACA3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SPACA3 promoter	CTD	PMID:27901495
Spaca3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SPACA3 mRNA	CTD	PMID:25181051
Spaca3	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SPACA3 gene	CTD	PMID:28505145
Spaca3	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of SPACA3 mRNA	CTD	PMID:27523638
Spaca3	Rat	lead diacetate	increases expression	ISO	Spaca3 (Mus musculus)	6480464	lead acetate results in increased expression of SPACA3 mRNA	CTD	PMID:20542052
Spaca3	Rat	paracetamol	affects expression	ISO	Spaca3 (Mus musculus)	6480464	Acetaminophen affects the expression of SPACA3 mRNA	CTD	PMID:17562736
Spaca3	Rat	silver atom	increases expression	ISO	Spaca3 (Mus musculus)	6480464	Silver results in increased expression of SPACA3 mRNA	CTD	PMID:27131904
Spaca3	Rat	silver(0)	increases expression	ISO	Spaca3 (Mus musculus)	6480464	Silver results in increased expression of SPACA3 mRNA	CTD	PMID:27131904
Spaca3	Rat	sodium arsenite	increases expression	ISO	SPACA3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of SPACA3 mRNA	CTD	PMID:38568856
Spaca3	Rat	sodium arsenite	decreases expression	ISO	Spaca3 (Mus musculus)	6480464	sodium arsenite results in decreased expression of SPACA3 mRNA	CTD	PMID:37682722
Spaca3	Rat	sodium fluoride	increases expression	ISO	Spaca3 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of SPACA3 protein	CTD	PMID:28918527
Spaca3	Rat	titanium dioxide	decreases expression	ISO	Spaca3 (Mus musculus)	6480464	titanium dioxide results in decreased expression of SPACA3 mRNA	CTD	PMID:35295148
Spaca3	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of SPACA3 mRNA	CTD	PMID:33387578

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spaca3	Rat	fusion of sperm to egg plasma membrane involved in single fertilization	involved_in	ISO	SPACA3 (Homo sapiens)	1624291	PMID:15982649	RGD	PMID:15982649
Spaca3	Rat	fusion of sperm to egg plasma membrane involved in single fertilization	involved_in	IBA	MGI:1922872 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Spaca3	Rat	fusion of sperm to egg plasma membrane involved in single fertilization	involved_in	ISO	Spaca3 (Mus musculus)	1624291	PMID:15982649	RGD	PMID:15982649
Spaca3	Rat	sperm-egg recognition	acts_upstream_of_or_within	ISO	Spaca3 (Mus musculus)	1624291	PMID:15982649	RGD	PMID:15982649

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spaca3	Rat	acrosomal matrix	located_in	ISO	SPACA3 (Homo sapiens)	1624291	PMID:12606493	RGD	PMID:12606493
Spaca3	Rat	acrosomal membrane	located_in	ISO	SPACA3 (Homo sapiens)	1624291	PMID:12606493	RGD	PMID:12606493
Spaca3	Rat	acrosomal vesicle	located_in	ISO	Spaca3 (Mus musculus)	1624291	PMID:15982649	RGD	PMID:15982649
Spaca3	Rat	acrosomal vesicle	is_active_in	IBA	MGI:1916282 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Spaca3	Rat	secretory granule	located_in	ISO	SPACA3 (Homo sapiens)	1624291	PMID:3470418	RGD	PMID:3470418
Spaca3	Rat	sperm flagellum	is_active_in	IBA	MGI:1916282 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spaca3	Rat	lysozyme activity	NOT\|enables	ISO	SPACA3 (Homo sapiens)	1624291	PMID:12606493	RGD	PMID:12606493
Spaca3	Rat	protein binding	enables	ISO	SPACA3 (Homo sapiens)	1624291	UniProtKB:O14656-2 more ...	RGD	PMID:19945174 and PMID:32814053
Spaca3	Rat	protein binding	enables	ISO	Spaca3 (Mus musculus)	1624291	UniProtKB:Q6HA09 and PMID:22206759	RGD	PMID:22206759

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:3470418	PMID:5154881	PMID:12606493	PMID:15982649

Spaca3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	66,348,336 - 66,355,808 (+)	NCBI		GRCr8
mRatBN7.2	10	65,850,618 - 65,858,090 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	65,854,893 - 65,858,094 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	70,478,623 - 70,486,095 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	69,983,949 - 69,991,421 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	65,445,229 - 65,452,710 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	68,227,736 - 68,235,295 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	68,232,094 - 68,235,295 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	67,895,784 - 67,903,343 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	69,083,140 - 69,090,699 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	69,096,841 - 69,104,318 (+)	NCBI
Celera	10	64,808,885 - 64,816,434 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

SPACA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	32,991,847 - 32,997,877 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	32,970,376 - 32,997,877 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	31,318,865 - 31,324,895 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	28,342,995 - 28,349,005 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	28,342,994 - 28,349,005	NCBI
Celera	17	28,229,875 - 28,235,888 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	27,504,194 - 27,510,279 (+)	NCBI		HuRef
CHM1_1	17	31,382,050 - 31,388,058 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	33,937,912 - 33,943,948 (+)	NCBI		T2T-CHM13v2.0

Spaca3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	80,749,189 - 80,758,640 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	80,749,191 - 80,758,640 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	80,858,363 - 80,867,814 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	80,858,365 - 80,867,814 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	80,671,891 - 80,681,316 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	80,674,556 - 80,684,009 (+)	NCBI		MGSCv36	mm8
Celera	11	90,497,433 - 90,506,937 (+)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	48.4	NCBI

Spaca3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	7,836,097 - 7,840,189 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	7,832,518 - 7,840,130 (+)	NCBI	ChiLan1.0	ChiLan1.0

SPACA3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	31,455,285 - 31,479,018 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	33,347,582 - 33,360,089 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	23,789,295 - 23,810,711 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	24,081,007 - 24,086,998 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	24,081,007 - 24,086,998 (-)	Ensembl	panpan1.1		panPan2

SPACA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	40,096,178 - 40,103,848 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	40,096,180 - 40,103,817 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	39,255,315 - 39,262,933 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	40,912,147 - 40,919,818 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	40,912,154 - 40,957,005 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	39,698,046 - 39,705,657 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	39,992,370 - 39,999,976 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	40,067,307 - 40,074,925 (-)	NCBI		UU_Cfam_GSD_1.0

Spaca3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	37,087,047 - 37,091,350 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937919	18,181 - 19,789 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937919	18,190 - 19,789 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPACA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	42,046,729 - 42,054,946 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	42,046,804 - 42,050,684 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	43,717,669 - 43,725,784 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPACA3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	26,526,449 - 26,533,604 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	3,503,668 - 3,509,637 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spaca3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624875	953,745 - 959,912 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624875	951,862 - 959,810 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Spaca3
13 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000009172
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1331839	Eae18b	Experimental allergic encephalomyelitis QTL 18b	5.8	0.03	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	61248303	67785171	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631526	Bp76	Blood pressure QTL 76		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	61345413	66743655	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	3	2	20	7	7	4	4	4	5	24	7	14	2	30	3


RefSeq Transcripts	NM_001105820	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HG931783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009172 ⟹ ENSRNOP00000009171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	65,854,893 - 65,858,094 (+)	Ensembl
Rnor_6.0 Ensembl	10	68,232,094 - 68,235,295 (+)	Ensembl

RefSeq Acc Id:

NM_001105820 ⟹ NP_001099290

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	66,348,336 - 66,355,808 (+)	NCBI
mRatBN7.2	10	65,850,618 - 65,858,090 (+)	NCBI
Rnor_6.0	10	68,227,736 - 68,235,295 (+)	NCBI
Rnor_5.0	10	67,895,784 - 67,903,343 (+)	NCBI
RGSC_v3.4	10	69,083,140 - 69,090,699 (+)	RGD
Celera	10	64,808,885 - 64,816,434 (+)	RGD

Sequence:

show sequence

CAGAAGGGCTTAGGTCAATTTGGAGTCCGATTTCTCCATCCTTCTCTTAATGCCGCGTGCTGGGACGCTGGCACGATTGCAAAGGGTGTCCTGAGCTGAATCAGGACTTGGATCCACAGCCACTGCTG
TCATTGTCACCACCATTTCAGCTCTGGTAGGGAGGACTCTTGATCTGGGTATATGCAAGTCTATGTAAGCCTGTGAAGGGCATCAGATATTCATCAGATATTCTGGAGCTGGGTTACAGATGATGGGG
CAGCTGTCTGGACTCTTGATCAGGGCTGGTGAACTGTCTGCCATCCCACAGTTCAGCCCTCTACCTGTGCCATCGCATGGAAGCTAGGAGCCGGGCTCCCAGAAGACAGCCGTGCCCGCCTGGGATCA
CTTGGCTGGCCCTGGCCTATCTGCTCAGCTGCCTGCTTGCCTCCAGCAAGGCCAAGGTCTTCAGTCGCTGTGAGCTGGCCAAAGTGCTGCATGACTTCGGTCTGGAAGGCTACAGGGGATATAACCTG
GCTGACTGGATCTGCCTTGCGTACTACACAAGCGGCTTCAATACGGATGCTGTGGATCACGAAGCTGACGGAAGCACCAACAACGGCATCTTCCAGATCAGCAGCCGGAAGTGGTGCAAAAACCTCGC
CCCGAACGGCCCCAATCTTTGCAGGATATACTGCACGGATTTGTTGAGCAATGATCTCAAAGATTCTGTCGCCTGTGTCATGAAGATAGCGCAAGAGCCCCAGGGCCTGGGCTACTGGGAATCCTGGA
AGCACCATTGTCAGGGCAGGGACCTCAGTGACTGGGTGGATGGCTGTGACTTCTAGGACCCTCTCTGGATGGACTAAGCCACACACAGCTGGCTGGGAAGTGTGGGCTTGTTCCTGACCCAGGCTTGG
GAAGACAAGCCAAGTAATAAAAGTCTAATTTGACAGAAACATG

hide sequence


Protein RefSeqs	NP_001099290	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CDM98784	(Get FASTA)	NCBI Sequence Viewer
	EDM05431	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009171.6

RefSeq Acc Id:	NP_001099290 ⟸ NM_001105820
- Peptide Label:	precursor
- UniProtKB:	F1M6E7 (UniProtKB/TrEMBL), A6HHC6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEARSRAPRRQPCPPGITWLALAYLLSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVDHEADGSTNNGIFQISSRKWCKNLAPNGPNLCRIYCTDLLSNDLKDSVAC VMKIAQEPQGLGYWESWKHHCQGRDLSDWVDGCDF hide sequence

Ensembl Acc Id:

ENSRNOP00000009171 ⟸ ENSRNOT00000009172

Protein Domains

Glycosyl hydrolases family 22 (GH22)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M6E7-F1-model_v2	AlphaFold	F1M6E7	1-163	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-23957	BioCyc
Ensembl Genes	ENSRNOG00000006994	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009172.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.530.10	UniProtKB/TrEMBL
InterPro	Glyco_hydro_22	UniProtKB/TrEMBL
	Glyco_hydro_22_CS	UniProtKB/TrEMBL
	Glyco_hydro_22_lys	UniProtKB/TrEMBL
	Lysozyme-like_dom	UniProtKB/TrEMBL
KEGG Report	rno:287557	UniProtKB/TrEMBL
NCBI Gene	287557	ENTREZGENE
PANTHER	PTHR11407	UniProtKB/TrEMBL
	PTHR11407:SF25	UniProtKB/TrEMBL
Pfam	Lys	UniProtKB/TrEMBL
PhenoGen	Spaca3	PhenoGen
PRINTS	LYSOZYME	UniProtKB/TrEMBL
	LYZLACT	UniProtKB/TrEMBL
PROSITE	LACTALBUMIN_LYSOZYME_1	UniProtKB/TrEMBL
	LACTALBUMIN_LYSOZYME_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006994	RatGTEx
SMART	LYZ1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF53955	UniProtKB/TrEMBL
UniProt	A6HHC6	ENTREZGENE, UniProtKB/TrEMBL
	F1M6E7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Spaca3	sperm acrosome associated 3	Spaca3_predicted	sperm acrosome associated 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Spaca3_predicted	sperm acrosome associated 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message