Symbol:
Zfp189
Name:
zinc finger protein 189
RGD ID:
1306510
Description:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Orthologous to human ZNF189 (zinc finger protein 189); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC313219
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ZNF189 (zinc finger protein 189) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Zfp189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Znf189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ZNF189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ZNF189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Znf189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ZNF189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ZNF189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Znf189 (zinc finger protein 189) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ZNF189 (zinc finger protein 189)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Zfp189 (zinc finger protein 189)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:113295
Alliance
DIOPT (Ensembl Compara|OMA)
Danio rerio (zebrafish):
znf1136 (zinc finger protein 1136)
Alliance
DIOPT (Hieranoid|OMA)
Caenorhabditis elegans (roundworm):
Y55F3AM.14
Alliance
DIOPT (Hieranoid|InParanoid|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ZAP1
Alliance
DIOPT (Hieranoid|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 68,668,225 - 68,679,606 (+) NCBI GRCr8 mRatBN7.2 5 63,872,596 - 63,884,348 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 63,872,738 - 63,884,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 65,803,448 - 65,815,282 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 67,622,780 - 67,634,614 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 67,592,160 - 67,603,994 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,789,432 - 64,801,079 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,789,456 - 64,800,810 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 69,280,812 - 69,292,492 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 66,266,848 - 66,278,203 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 66,272,310 - 66,283,349 (+) NCBI Celera 5 63,723,898 - 63,735,254 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zfp189 Rat 1,2-dimethylhydrazine decreases expression ISO Zfp189 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ZFP189 mRNA CTD PMID:22206623 Zfp189 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ZFP189 mRNA CTD PMID:30723492 Zfp189 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ZFP189 mRNA CTD PMID:32145629 Zfp189 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Zfp189 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ZFP189 mRNA CTD PMID:22298810 Zfp189 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZFP189 mRNA CTD PMID:21215274 and PMID:21724226 Zfp189 Rat 2-methylcholine affects expression ISO ZNF189 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ZNF189 mRNA CTD PMID:21179406 Zfp189 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Zfp189 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ZFP189 mRNA CTD PMID:20188158 Zfp189 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZNF189 mRNA CTD PMID:28628672 Zfp189 Rat 5-azacytidine decreases expression ISO ZNF189 (Homo sapiens) 6480464 Azacitidine results in decreased expression of ZNF189 mRNA CTD PMID:20823114 Zfp189 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ZFP189 mRNA CTD PMID:24780913 Zfp189 Rat aflatoxin B1 decreases expression ISO ZNF189 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ZNF189 mRNA CTD PMID:22100608 Zfp189 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ZFP189 mRNA CTD PMID:23385219 Zfp189 Rat aflatoxin M1 decreases expression ISO ZNF189 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of ZNF189 mRNA CTD PMID:30928695 Zfp189 Rat arsane multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZNF189 mRNA CTD PMID:39836092 Zfp189 Rat arsenic atom multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZNF189 mRNA CTD PMID:39836092 Zfp189 Rat benzo[a]pyrene decreases expression ISO ZNF189 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ZNF189 mRNA CTD PMID:32234424 Zfp189 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZNF189 mRNA CTD PMID:25181051 Zfp189 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ZFP189 mRNA CTD PMID:32145629 Zfp189 Rat bisphenol F multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZNF189 mRNA CTD PMID:28628672 Zfp189 Rat cadmium atom multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZNF189 mRNA CTD PMID:35301059 Zfp189 Rat cadmium dichloride multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZNF189 mRNA CTD PMID:35301059 Zfp189 Rat carmustine increases expression EXP 6480464 Carmustine results in increased expression of ZNF189 mRNA CTD PMID:16005536 Zfp189 Rat chlorpyrifos increases expression ISO Zfp189 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ZFP189 mRNA CTD PMID:37019170 Zfp189 Rat copper(II) sulfate decreases expression ISO ZNF189 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ZNF189 mRNA CTD PMID:19549813 Zfp189 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ZFP189 mRNA CTD PMID:26577399 Zfp189 Rat cyclosporin A increases expression ISO Zfp189 (Mus musculus) 6480464 Cyclosporine results in increased expression of ZFP189 mRNA CTD PMID:25270620 Zfp189 Rat cyclosporin A decreases expression ISO ZNF189 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ZNF189 mRNA CTD PMID:20106945 and PMID:25562108 Zfp189 Rat dexamethasone multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZNF189 mRNA CTD PMID:28628672 Zfp189 Rat dicrotophos decreases expression ISO ZNF189 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ZNF189 mRNA CTD PMID:28302478 Zfp189 Rat doxorubicin decreases expression ISO ZNF189 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ZNF189 mRNA CTD PMID:29803840 Zfp189 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ZFP189 mRNA CTD PMID:29391264 Zfp189 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ZFP189 mRNA CTD PMID:33387578 Zfp189 Rat geraniol increases expression ISO ZNF189 (Homo sapiens) 6480464 geraniol results in increased expression of ZNF189 mRNA CTD PMID:27683099 Zfp189 Rat GSK-J4 decreases expression ISO ZNF189 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of ZNF189 mRNA CTD PMID:29301935 Zfp189 Rat indometacin multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZNF189 mRNA CTD PMID:28628672 Zfp189 Rat lead(0) affects expression ISO ZNF189 (Homo sapiens) 6480464 Lead affects the expression of ZNF189 mRNA CTD PMID:28903495 Zfp189 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in increased expression of ZFP189 mRNA CTD PMID:19564919 Zfp189 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of ZFP189 mRNA CTD PMID:19564919 Zfp189 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ZFP189 mRNA CTD PMID:30467583 Zfp189 Rat methotrexate increases expression EXP 6480464 Methotrexate results in increased expression of ZNF189 mRNA CTD PMID:16005536 Zfp189 Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of ZFP189 mRNA CTD PMID:28349193 Zfp189 Rat okadaic acid decreases expression ISO ZNF189 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of ZNF189 mRNA CTD PMID:38832940 Zfp189 Rat paracetamol affects expression ISO Zfp189 (Mus musculus) 6480464 Acetaminophen affects the expression of ZFP189 mRNA CTD PMID:17562736 Zfp189 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ZFP189 mRNA CTD PMID:33387578 Zfp189 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ZFP189 mRNA CTD PMID:32479839 Zfp189 Rat paracetamol increases expression ISO ZNF189 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ZNF189 mRNA CTD PMID:22230336 Zfp189 Rat paracetamol decreases expression ISO ZNF189 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ZNF189 mRNA CTD PMID:21420995 and PMID:29067470 Zfp189 Rat quercetin decreases expression ISO ZNF189 (Homo sapiens) 6480464 Quercetin results in decreased expression of ZNF189 mRNA CTD PMID:21632981 Zfp189 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in increased expression of ZFP189 mRNA CTD PMID:19564919 Zfp189 Rat sodium arsenite decreases expression ISO ZNF189 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ZNF189 mRNA CTD PMID:28595984 and PMID:34032870 Zfp189 Rat sodium arsenite multiple interactions ISO ZNF189 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZNF189 mRNA CTD PMID:39836092 Zfp189 Rat sodium arsenite increases expression ISO ZNF189 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ZNF189 mRNA CTD PMID:38568856 Zfp189 Rat sunitinib decreases expression ISO ZNF189 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ZNF189 mRNA CTD PMID:31533062 Zfp189 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ZFP189 mRNA CTD PMID:31150632 Zfp189 Rat tioguanine increases expression EXP 6480464 Thioguanine results in increased expression of ZNF189 mRNA CTD PMID:16005536 Zfp189 Rat titanium dioxide decreases methylation ISO Zfp189 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ZFP189 gene CTD PMID:35295148 Zfp189 Rat triphenyl phosphate affects expression ISO ZNF189 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ZNF189 mRNA CTD PMID:37042841 Zfp189 Rat urethane decreases expression ISO ZNF189 (Homo sapiens) 6480464 Urethane results in decreased expression of ZNF189 mRNA CTD PMID:28818685 Zfp189 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of ZFP189 mRNA CTD PMID:24136188 Zfp189 Rat valproic acid affects expression ISO Zfp189 (Mus musculus) 6480464 Valproic Acid affects the expression of ZFP189 mRNA CTD PMID:17292431 Zfp189 Rat valproic acid decreases expression ISO ZNF189 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ZNF189 mRNA CTD PMID:23179753 and PMID:28001369 Zfp189 Rat valproic acid affects expression ISO ZNF189 (Homo sapiens) 6480464 Valproic Acid affects the expression of ZNF189 mRNA CTD PMID:25979313 Zfp189 Rat valproic acid decreases methylation ISO ZNF189 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ZNF189 gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carmustine (EXP) chlorpyrifos (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dicrotophos (ISO) doxorubicin (ISO) endosulfan (EXP) gentamycin (EXP) geraniol (ISO) GSK-J4 (ISO) indometacin (ISO) lead(0) (ISO) methamphetamine (EXP) methapyrilene (EXP) methotrexate (EXP) Methylazoxymethanol acetate (EXP) okadaic acid (ISO) paracetamol (EXP,ISO) quercetin (ISO) SCH 23390 (EXP) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) tioguanine (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO)
Zfp189 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 68,668,225 - 68,679,606 (+) NCBI GRCr8 mRatBN7.2 5 63,872,596 - 63,884,348 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 63,872,738 - 63,884,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 65,803,448 - 65,815,282 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 67,622,780 - 67,634,614 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 67,592,160 - 67,603,994 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,789,432 - 64,801,079 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,789,456 - 64,800,810 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 69,280,812 - 69,292,492 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 66,266,848 - 66,278,203 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 66,272,310 - 66,283,349 (+) NCBI Celera 5 63,723,898 - 63,735,254 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
ZNF189 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 101,398,851 - 101,410,654 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 101,398,851 - 101,410,660 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 104,161,133 - 104,172,936 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 103,200,984 - 103,212,763 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 101,240,717 - 101,252,497 NCBI Celera 9 74,674,768 - 74,686,547 (+) NCBI Celera Cytogenetic Map 9 q31.1 NCBI HuRef 9 73,760,586 - 73,772,393 (+) NCBI HuRef CHM1_1 9 104,307,549 - 104,319,358 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 113,570,826 - 113,582,630 (+) NCBI T2T-CHM13v2.0
Zfp189 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 49,521,176 - 49,531,558 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 49,521,176 - 49,531,517 (+) Ensembl GRCm39 Ensembl GRCm38 4 49,521,176 - 49,531,558 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 49,521,176 - 49,531,517 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 49,534,089 - 49,544,417 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 49,542,326 - 49,552,641 (+) NCBI MGSCv36 mm8 Celera 4 49,549,471 - 49,559,799 (+) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 26.55 NCBI
Znf189 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 24,404,827 - 24,416,093 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 24,403,858 - 24,416,395 (-) NCBI ChiLan1.0 ChiLan1.0
ZNF189 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 37,951,986 - 37,963,935 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 37,954,358 - 37,966,308 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 72,607,439 - 72,619,319 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 100,601,555 - 100,613,409 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 100,601,561 - 100,613,409 (+) Ensembl panpan1.1 panPan2
ZNF189 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 58,129,654 - 58,141,727 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 58,129,001 - 58,140,713 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 56,574,085 - 56,587,449 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 59,265,136 - 59,278,502 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 59,266,174 - 59,278,499 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 57,774,881 - 57,788,233 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 57,787,957 - 57,801,309 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 58,485,508 - 58,498,883 (+) NCBI UU_Cfam_GSD_1.0
Znf189 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 173,017,018 - 173,028,296 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 9,564,941 - 9,574,761 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 9,564,599 - 9,575,783 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZNF189 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 243,106,974 - 243,118,344 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 243,106,911 - 243,117,929 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 271,660,787 - 271,718,975 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZNF189
Znf189
.
Predicted Target Of
Count of predictions: 482 Count of miRNA genes: 261 Interacting mature miRNAs: 322 Transcripts: ENSRNOT00000009584 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 1598814 Mcs13 Mammary carcinoma susceptibility QTL 13 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 63190890 69927503 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH131427
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 63,883,737 - 63,883,920 (+) MAPPER mRatBN7.2 Rnor_6.0 5 64,800,465 - 64,800,647 NCBI Rnor6.0 Rnor_5.0 5 69,291,878 - 69,292,060 UniSTS Rnor5.0 RGSC_v3.4 5 66,277,858 - 66,278,040 UniSTS RGSC3.4 Celera 5 63,724,061 - 63,724,243 UniSTS RH 3.4 Map 5 423.9 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009584 ⟹ ENSRNOP00000009584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 63,872,738 - 63,884,083 (+) Ensembl Rnor_6.0 Ensembl 5 64,789,456 - 64,800,810 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078502 ⟹ ENSRNOP00000071391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 63,876,859 - 63,884,121 (+) Ensembl Rnor_6.0 Ensembl 5 64,790,186 - 64,800,240 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100201 ⟹ ENSRNOP00000080343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 63,872,897 - 63,884,083 (+) Ensembl
RefSeq Acc Id:
NM_001107930 ⟹ NP_001101400
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 68,668,225 - 68,679,579 (+) NCBI mRatBN7.2 5 63,872,729 - 63,884,083 (+) NCBI Rnor_6.0 5 64,789,456 - 64,800,810 (+) NCBI Rnor_5.0 5 69,280,812 - 69,292,492 (+) NCBI RGSC_v3.4 5 66,266,848 - 66,278,203 (+) RGD Celera 5 63,723,898 - 63,735,254 (-) RGD
Sequence:
GTAGTTAGACAGGTTCCGCGTAGGCTCCGGGTAACGCCTTCTGGTCCGGGGGTGGTCGGTAGTAGTGCAGCTTGACTTTGAGGCGGAGGACTTGGCAACAAGGAGGAGATATTACAGGGAGGCCCGAA
hide sequence
RefSeq Acc Id:
XM_006238157 ⟹ XP_006238219
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 68,668,256 - 68,679,606 (+) NCBI mRatBN7.2 5 63,872,596 - 63,884,348 (+) NCBI Rnor_6.0 5 64,789,432 - 64,801,079 (+) NCBI Rnor_5.0 5 69,280,812 - 69,292,492 (+) NCBI
Sequence:
CGCTCCGTGGGCATGTTGGGAGTTGTAGTTAGACAGGTTCCGCGTAGGCTCCGGGTAACGCCTT
hide sequence
RefSeq Acc Id:
XM_039109853 ⟹ XP_038965781
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 68,672,187 - 68,679,606 (+) NCBI mRatBN7.2 5 63,873,865 - 63,884,348 (+) NCBI
RefSeq Acc Id:
XM_039109854 ⟹ XP_038965782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 68,669,775 - 68,679,606 (+) NCBI mRatBN7.2 5 63,873,971 - 63,884,348 (+) NCBI
RefSeq Acc Id:
NP_001101400 ⟸ NM_001107930
- UniProtKB:
A6KJE3 (UniProtKB/TrEMBL)
- Sequence:
MASPSPPLESKEEWGYLDAAPRSLYKDVVMDSYGKLVSLDVLNRNEDEEPTVKEEIEKDIEPQGIIVTRIKSELDQDPMGSETFELVGRLDKQRGIFLWEIPRDSLTEEQKMFRGHTNVRKRPNSEEK
hide sequence
RefSeq Acc Id:
XP_006238219 ⟸ XM_006238157
- Peptide Label:
isoform X1
- UniProtKB:
D3ZRX1 (UniProtKB/TrEMBL)
- Sequence:
MSGLKEEWGYLDAAPRSLYKDVVMDSYGKLVSLDVLNRNEDEEPTVKEEIEKDIEPQGIIVTRIKSELDQDPMGSETFELVGRLDKQRGIFLWEIPRDSLTEEQKMFRGHTNVRKRPNSEEKCHKCEE
hide sequence
Ensembl Acc Id:
ENSRNOP00000071391 ⟸ ENSRNOT00000078502
Ensembl Acc Id:
ENSRNOP00000009584 ⟸ ENSRNOT00000009584
RefSeq Acc Id:
XP_038965781 ⟸ XM_039109853
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K0C7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965782 ⟸ XM_039109854
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000080343 ⟸ ENSRNOT00000100201
RGD ID: 13693730 Promoter ID: EPDNEW_R4255 Type: initiation region Name: Zfp189_1 Description: zinc finger protein 189 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 64,789,516 - 64,789,576 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Zfp189
zinc finger protein 189
Zfp189_predicted
zinc finger protein 189 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Zfp189_predicted
zinc finger protein 189 (predicted)
Symbol and Name status set to approved
70820 APPROVED
