Symbol:
Rasip1
Name:
Ras interacting protein 1
RGD ID:
1305291
Description:
Predicted to enable GTPase binding activity and protein homodimerization activity. Predicted to be involved in several processes, including negative regulation of Rho protein signal transduction; negative regulation of metabolic process; and tube morphogenesis. Predicted to be part of protein-containing complex. Predicted to be active in cell-cell junction. Orthologous to human RASIP1 (Ras interacting protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC292912; ras-interacting protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RASIP1 (Ras interacting protein 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Rasip1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rasip1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RASIP1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RASIP1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rasip1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RASIP1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RASIP1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rasip1 (Ras interacting protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IZUMO1 (izumo sperm-oocyte fusion 1) HGNC
EggNOG, PhylomeDB, Treefam
Homo sapiens (human):
HROB (homologous recombination factor with OB-fold) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RASIP1 (Ras interacting protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rasip1 (Ras interacting protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rasip1 (Ras interacting protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rasip1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,233,599 - 105,246,028 (+) NCBI GRCr8 mRatBN7.2 1 96,097,135 - 96,109,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,091,074 - 96,109,562 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,482,573 - 101,495,002 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,955,274 - 109,967,703 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,245,644 - 103,258,074 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,609,209 - 101,621,648 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,610,773 - 101,621,646 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,687,843 - 102,700,428 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,097,668 - 96,108,543 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,174,114 - 96,186,654 (+) NCBI Celera 1 90,352,345 - 90,363,220 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rasip1 Rat 1,2-dimethylhydrazine increases expression ISO Rasip1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of RASIP1 mRNA CTD PMID:22206623 Rasip1 Rat 17alpha-ethynylestradiol affects expression ISO Rasip1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RASIP1 mRNA CTD PMID:17555576 Rasip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RASIP1 mRNA CTD PMID:22298810 Rasip1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RASIP1 mRNA CTD PMID:33387578 Rasip1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RASIP1 mRNA CTD PMID:34747641 Rasip1 Rat 4,4'-sulfonyldiphenol increases expression ISO Rasip1 (Mus musculus) 6480464 bisphenol S results in increased expression of RASIP1 mRNA CTD PMID:30951980 Rasip1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Rasip1 (Mus musculus) 6480464 bisphenol S affects the methylation of RASIP1 gene CTD PMID:31683443 Rasip1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Rasip1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of RASIP1 exon CTD PMID:33297965 Rasip1 Rat 4-hydroxyphenyl retinamide increases expression ISO Rasip1 (Mus musculus) 6480464 Fenretinide results in increased expression of RASIP1 mRNA CTD PMID:28973697 Rasip1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RASIP1 mRNA CTD PMID:30047161 Rasip1 Rat 8-Br-cAMP decreases expression ISO RASIP1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of RASIP1 mRNA CTD PMID:22079614 Rasip1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RASIP1 mRNA CTD PMID:35163327 Rasip1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RASIP1 mRNA CTD PMID:30047161 Rasip1 Rat arsane affects methylation ISO RASIP1 (Homo sapiens) 6480464 Arsenic affects the methylation of RASIP1 gene CTD PMID:25304211 Rasip1 Rat arsenic atom affects methylation ISO RASIP1 (Homo sapiens) 6480464 Arsenic affects the methylation of RASIP1 gene CTD PMID:25304211 Rasip1 Rat atrazine increases expression ISO RASIP1 (Homo sapiens) 6480464 Atrazine results in increased expression of RASIP1 mRNA CTD PMID:22378314 Rasip1 Rat benzo[a]pyrene increases expression ISO Rasip1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RASIP1 mRNA CTD PMID:21964900 and PMID:32417428 Rasip1 Rat benzo[a]pyrene affects methylation ISO RASIP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RASIP1 promoter CTD PMID:27901495 Rasip1 Rat bisphenol A multiple interactions ISO RASIP1 (Homo sapiens) 6480464 [Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of RASIP1 protein CTD PMID:31629898 Rasip1 Rat bisphenol A increases expression ISO RASIP1 (Homo sapiens) 6480464 bisphenol A analog results in increased expression of RASIP1 mRNA CTD PMID:32387340 Rasip1 Rat bisphenol A increases expression ISO Rasip1 (Mus musculus) 6480464 bisphenol A results in increased expression of RASIP1 mRNA CTD PMID:30951980 more ... Rasip1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RASIP1 mRNA CTD PMID:30816183 Rasip1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RASIP1 mRNA CTD PMID:25181051 Rasip1 Rat bisphenol F increases expression ISO Rasip1 (Mus musculus) 6480464 bisphenol F results in increased expression of RASIP1 mRNA CTD PMID:30951980 Rasip1 Rat bisphenol F decreases expression ISO Rasip1 (Mus musculus) 6480464 bisphenol F results in decreased expression of RASIP1 mRNA CTD PMID:38685157 Rasip1 Rat butan-1-ol multiple interactions ISO RASIP1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA CTD PMID:29432896 Rasip1 Rat butanal increases expression ISO RASIP1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of RASIP1 mRNA CTD PMID:26079696 Rasip1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of RASIP1 promoter CTD PMID:22457795 Rasip1 Rat CGP 52608 multiple interactions ISO RASIP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RASIP1 gene] CTD PMID:28238834 Rasip1 Rat chlorpyrifos increases expression ISO Rasip1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RASIP1 mRNA CTD PMID:37019170 Rasip1 Rat choline multiple interactions ISO Rasip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene CTD PMID:20938992 Rasip1 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of RASIP1 mRNA CTD PMID:30047161 Rasip1 Rat DDE decreases expression ISO RASIP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of RASIP1 mRNA CTD PMID:38568856 Rasip1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of RASIP1 mRNA CTD PMID:21266533 Rasip1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RASIP1 mRNA CTD PMID:29391264 Rasip1 Rat ethanol multiple interactions ISO RASIP1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA CTD PMID:29432896 Rasip1 Rat etoposide affects response to substance ISO RASIP1 (Homo sapiens) 6480464 RASIP1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Rasip1 Rat folic acid multiple interactions ISO Rasip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene CTD PMID:20938992 Rasip1 Rat FR900359 increases phosphorylation ISO RASIP1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of RASIP1 protein CTD PMID:37730182 Rasip1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of RASIP1 mRNA CTD PMID:22061828 and PMID:33387578 Rasip1 Rat hydrogen peroxide affects expression ISO RASIP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RASIP1 mRNA CTD PMID:20044591 Rasip1 Rat isobutanol multiple interactions ISO RASIP1 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA CTD PMID:29432896 Rasip1 Rat L-methionine multiple interactions ISO Rasip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene CTD PMID:20938992 Rasip1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RASIP1 mRNA CTD PMID:30047161 Rasip1 Rat ozone multiple interactions ISO Rasip1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of RASIP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of RASIP1 mRNA CTD PMID:34911549 Rasip1 Rat paracetamol affects expression ISO Rasip1 (Mus musculus) 6480464 Acetaminophen affects the expression of RASIP1 mRNA CTD PMID:17562736 Rasip1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RASIP1 mRNA CTD PMID:35163327 Rasip1 Rat phenol red multiple interactions ISO RASIP1 (Homo sapiens) 6480464 [Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of RASIP1 protein CTD PMID:31629898 Rasip1 Rat sodium arsenite increases expression ISO RASIP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RASIP1 mRNA CTD PMID:38568856 Rasip1 Rat sodium arsenite affects expression ISO RASIP1 (Homo sapiens) 6480464 sodium arsenite affects the expression of RASIP1 mRNA CTD PMID:34032870 Rasip1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of RASIP1 mRNA CTD PMID:30047161 Rasip1 Rat sunitinib increases expression ISO RASIP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of RASIP1 mRNA CTD PMID:31533062 Rasip1 Rat tamoxifen affects expression ISO Rasip1 (Mus musculus) 6480464 Tamoxifen affects the expression of RASIP1 mRNA CTD PMID:17555576 Rasip1 Rat titanium dioxide decreases methylation ISO Rasip1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RASIP1 gene CTD PMID:35295148 Rasip1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of RASIP1 mRNA CTD PMID:33387578 Rasip1 Rat trimellitic anhydride decreases expression ISO Rasip1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of RASIP1 mRNA CTD PMID:19042947 Rasip1 Rat troglitazone increases expression ISO Rasip1 (Mus musculus) 6480464 troglitazone results in increased expression of RASIP1 mRNA CTD PMID:17569031 Rasip1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of RASIP1 mRNA CTD PMID:19015723 Rasip1 Rat vorinostat decreases expression ISO RASIP1 (Homo sapiens) 6480464 vorinostat results in decreased expression of RASIP1 mRNA CTD PMID:27188386 Rasip1 Rat zinc atom decreases expression ISO RASIP1 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of RASIP1 mRNA CTD PMID:18356318 Rasip1 Rat zinc(0) decreases expression ISO RASIP1 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of RASIP1 mRNA CTD PMID:18356318
Rasip1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,233,599 - 105,246,028 (+) NCBI GRCr8 mRatBN7.2 1 96,097,135 - 96,109,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,091,074 - 96,109,562 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 101,482,573 - 101,495,002 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 109,955,274 - 109,967,703 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,245,644 - 103,258,074 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 101,609,209 - 101,621,648 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 101,610,773 - 101,621,646 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 102,687,843 - 102,700,428 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,097,668 - 96,108,543 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,174,114 - 96,186,654 (+) NCBI Celera 1 90,352,345 - 90,363,220 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
RASIP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 48,720,585 - 48,740,610 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 48,720,585 - 48,740,610 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 49,223,842 - 49,243,867 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 53,915,654 - 53,935,782 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 53,915,653 - 53,935,782 NCBI Celera 19 46,089,934 - 46,110,062 (-) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 45,603,007 - 45,622,781 (-) NCBI HuRef CHM1_1 19 49,225,580 - 49,245,732 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 51,715,002 - 51,735,029 (-) NCBI T2T-CHM13v2.0
Rasip1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 45,276,961 - 45,288,516 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 45,276,912 - 45,288,517 (+) Ensembl GRCm39 Ensembl GRCm38 7 45,627,537 - 45,639,092 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 45,627,488 - 45,639,093 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 52,882,907 - 52,894,462 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 45,495,579 - 45,507,134 (+) NCBI MGSCv36 mm8 Celera 7 41,089,079 - 41,100,635 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 29.39 NCBI
Rasip1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 1,831,123 - 1,843,905 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 1,830,574 - 1,844,107 (+) NCBI ChiLan1.0 ChiLan1.0
RASIP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 54,823,848 - 54,843,803 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 56,750,190 - 56,770,147 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 45,720,179 - 45,740,131 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 54,311,649 - 54,318,585 (-) NCBI panpan1.1 PanPan1.1 panPan2
RASIP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 107,583,169 - 107,597,683 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 107,581,424 - 107,597,682 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 107,105,550 - 107,119,765 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 108,107,785 - 108,121,968 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 108,107,111 - 108,121,992 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 107,774,623 - 107,788,818 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 107,421,540 - 107,435,931 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 108,257,120 - 108,271,542 (+) NCBI UU_Cfam_GSD_1.0
Rasip1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 21,125,378 - 21,137,442 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936664 2,743,564 - 2,754,395 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936664 2,743,568 - 2,754,618 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RASIP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 54,058,759 - 54,072,459 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 54,058,748 - 54,072,415 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 49,806,097 - 49,819,876 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RASIP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 41,970,704 - 41,997,951 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 41,991,176 - 41,996,155 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 21,840,051 - 21,860,422 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rasip1
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 31 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000032535 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
AI853551
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 96,109,346 - 96,109,441 (+) MAPPER mRatBN7.2 Rnor_6.0 1 101,621,431 - 101,621,525 NCBI Rnor6.0 Rnor_5.0 1 102,700,211 - 102,700,305 UniSTS Rnor5.0 RGSC_v3.4 1 96,108,326 - 96,108,420 UniSTS RGSC3.4 Celera 1 90,363,003 - 90,363,097 UniSTS Cytogenetic Map 1 q22 UniSTS
RH128437
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 96,109,285 - 96,109,499 (+) MAPPER mRatBN7.2 Rnor_6.0 1 101,621,370 - 101,621,583 NCBI Rnor6.0 Rnor_5.0 1 102,700,150 - 102,700,363 UniSTS Rnor5.0 RGSC_v3.4 1 96,108,265 - 96,108,478 UniSTS RGSC3.4 Celera 1 90,362,942 - 90,363,155 UniSTS RH 3.4 Map 1 908.8 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032535 ⟹ ENSRNOP00000034336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,098,689 - 96,109,562 (+) Ensembl Rnor_6.0 Ensembl 1 101,610,773 - 101,621,646 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000033278 ⟹ ENSRNOP00000035119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,091,074 - 96,109,562 (+) Ensembl
RefSeq Acc Id:
NM_001106261 ⟹ NP_001099731
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,233,599 - 105,246,028 (+) NCBI mRatBN7.2 1 96,097,135 - 96,109,564 (+) NCBI Rnor_6.0 1 101,610,773 - 101,621,648 (+) NCBI Rnor_5.0 1 102,687,843 - 102,700,428 (+) NCBI RGSC_v3.4 1 96,097,668 - 96,108,543 (+) RGD Celera 1 90,352,345 - 90,363,220 (+) RGD
Sequence:
GTCGGCTGGAGCAGGAGGCCTTCGGTGCTGCGGATGCAGACGGCACAAACGCCCCATCTTGGCGGACCCAGAAGAATAGGTCTCGGGCAGCATCTGGCGGGGCAGCTTTGGCCAGTCCTGGTCCAGGA
hide sequence
RefSeq Acc Id:
NP_001099731 ⟸ NM_001106261
- UniProtKB:
A0A8L2QHS0 (UniProtKB/TrEMBL)
- Sequence:
MAPGAADAQMVPTDPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGPSSSRGGSPAPYVDTFLNAPDILPRHCTVRAGPEPPAMVRPSRGAPVTHNGCLLLREAELHPGDL
hide sequence
Ensembl Acc Id:
ENSRNOP00000034336 ⟸ ENSRNOT00000032535
Ensembl Acc Id:
ENSRNOP00000035119 ⟸ ENSRNOT00000033278
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Rasip1
Ras interacting protein 1
Rasip1_predicted
Ras interacting protein 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rasip1_predicted
Ras interacting protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
