Advanced Search (OLGA)

Gene: Rasip1 (Ras interacting protein 1) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Rasip1

Name:

Ras interacting protein 1

RGD ID:

1313234

MGI Page

MGI

Description:

Predicted to enable protein homodimerization activity and small GTPase binding activity. Involved in angiogenesis; branching morphogenesis of an epithelial tube; and vasculogenesis. Predicted to be located in Golgi apparatus and perinuclear region of cytoplasm. Predicted to be part of protein-containing complex. Predicted to be active in cell-cell junction. Is expressed in several structures, including cardiovascular system; extraembryonic component; genitourinary system; nervous system; and vertebral axis musculature. Orthologous to human RASIP1 (Ras interacting protein 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1110025D03Rik; 2610025P08Rik; AI853551; MGC150078; Rain; ras-interacting protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RASIP1 (Ras interacting protein 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Rasip1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rasip1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RASIP1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RASIP1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rasip1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RASIP1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RASIP1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rasip1 (Ras interacting protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rasip1 (Ras interacting protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RASIP1 (Ras interacting protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rasip1 (Ras interacting protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	rasip1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	45,276,961 - 45,288,516 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	45,276,912 - 45,288,517 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,627,537 - 45,639,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,627,488 - 45,639,093 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,882,907 - 52,894,462 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	45,495,579 - 45,507,134 (+)	NCBI		MGSCv36	mm8
Celera	7	41,089,079 - 41,100,635 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.39	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rasip1	Mouse	1,2-dimethylhydrazine	increases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in increased expression of RASIP1 mRNA	CTD	PMID:22206623
Rasip1	Mouse	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of RASIP1 mRNA	CTD	PMID:17555576
Rasip1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin affects the expression of RASIP1 mRNA	CTD	PMID:22298810
Rasip1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of RASIP1 mRNA	CTD	PMID:33387578
Rasip1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of RASIP1 mRNA	CTD	PMID:34747641
Rasip1	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of RASIP1 mRNA	CTD	PMID:30951980
Rasip1	Mouse	4,4'-sulfonyldiphenol	affects methylation	EXP		6480464	bisphenol S affects the methylation of RASIP1 gene	CTD	PMID:31683443
Rasip1	Mouse	4,4'-sulfonyldiphenol	decreases methylation	EXP		6480464	bisphenol S results in decreased methylation of RASIP1 exon	CTD	PMID:33297965
Rasip1	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of RASIP1 mRNA	CTD	PMID:28973697
Rasip1	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of RASIP1 mRNA	CTD	PMID:30047161
Rasip1	Mouse	8-Br-cAMP	decreases expression	ISO	RASIP1 (Homo sapiens)	6480464	8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of RASIP1 mRNA	CTD	PMID:22079614
Rasip1	Mouse	alpha-Zearalanol	multiple interactions	ISO	Rasip1 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RASIP1 mRNA	CTD	PMID:35163327
Rasip1	Mouse	amitrole	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Amitrole results in increased expression of RASIP1 mRNA	CTD	PMID:30047161
Rasip1	Mouse	arsane	affects methylation	ISO	RASIP1 (Homo sapiens)	6480464	Arsenic affects the methylation of RASIP1 gene	CTD	PMID:25304211
Rasip1	Mouse	arsenic atom	affects methylation	ISO	RASIP1 (Homo sapiens)	6480464	Arsenic affects the methylation of RASIP1 gene	CTD	PMID:25304211
Rasip1	Mouse	atrazine	increases expression	ISO	RASIP1 (Homo sapiens)	6480464	Atrazine results in increased expression of RASIP1 mRNA	CTD	PMID:22378314
Rasip1	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of RASIP1 mRNA	CTD	PMID:21964900 and PMID:32417428
Rasip1	Mouse	benzo[a]pyrene	affects methylation	ISO	RASIP1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of RASIP1 promoter	CTD	PMID:27901495
Rasip1	Mouse	bisphenol A	affects expression	ISO	Rasip1 (Rattus norvegicus)	6480464	bisphenol A affects the expression of RASIP1 mRNA	CTD	PMID:25181051
Rasip1	Mouse	bisphenol A	increases expression	ISO	RASIP1 (Homo sapiens)	6480464	bisphenol A analog results in increased expression of RASIP1 mRNA	CTD	PMID:32387340
Rasip1	Mouse	bisphenol A	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	[Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of RASIP1 protein	CTD	PMID:31629898
Rasip1	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RASIP1 mRNA	CTD	PMID:30951980 more ...
Rasip1	Mouse	bisphenol A	decreases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of RASIP1 mRNA	CTD	PMID:30816183
Rasip1	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of RASIP1 mRNA	CTD	PMID:30951980
Rasip1	Mouse	bisphenol F	decreases expression	EXP		6480464	bisphenol F results in decreased expression of RASIP1 mRNA	CTD	PMID:38685157
Rasip1	Mouse	butan-1-ol	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA	CTD	PMID:29432896
Rasip1	Mouse	butanal	increases expression	ISO	RASIP1 (Homo sapiens)	6480464	butyraldehyde results in increased expression of RASIP1 mRNA	CTD	PMID:26079696
Rasip1	Mouse	cadmium dichloride	decreases methylation	ISO	Rasip1 (Rattus norvegicus)	6480464	Cadmium Chloride results in decreased methylation of RASIP1 promoter	CTD	PMID:22457795
Rasip1	Mouse	CGP 52608	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to RASIP1 gene]	CTD	PMID:28238834
Rasip1	Mouse	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of RASIP1 mRNA	CTD	PMID:37019170
Rasip1	Mouse	choline	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene	CTD	PMID:20938992
Rasip1	Mouse	clotrimazole	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Clotrimazole results in increased expression of RASIP1 mRNA	CTD	PMID:30047161
Rasip1	Mouse	DDE	decreases expression	ISO	RASIP1 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of RASIP1 mRNA	CTD	PMID:38568856
Rasip1	Mouse	dibutyl phthalate	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Dibutyl Phthalate results in increased expression of RASIP1 mRNA	CTD	PMID:21266533
Rasip1	Mouse	endosulfan	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Endosulfan results in increased expression of RASIP1 mRNA	CTD	PMID:29391264
Rasip1	Mouse	ethanol	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA	CTD	PMID:29432896
Rasip1	Mouse	etoposide	affects response to substance	ISO	RASIP1 (Homo sapiens)	6480464	RASIP1 protein affects the susceptibility to Etoposide	CTD	PMID:16217747
Rasip1	Mouse	folic acid	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene	CTD	PMID:20938992
Rasip1	Mouse	FR900359	increases phosphorylation	ISO	RASIP1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of RASIP1 protein	CTD	PMID:37730182
Rasip1	Mouse	gentamycin	decreases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of RASIP1 mRNA	CTD	PMID:22061828 and PMID:33387578
Rasip1	Mouse	hydrogen peroxide	affects expression	ISO	RASIP1 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of RASIP1 mRNA	CTD	PMID:20044591
Rasip1	Mouse	isobutanol	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of RASIP1 mRNA	CTD	PMID:29432896
Rasip1	Mouse	L-methionine	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RASIP1 gene	CTD	PMID:20938992
Rasip1	Mouse	methimazole	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Methimazole results in increased expression of RASIP1 mRNA	CTD	PMID:30047161
Rasip1	Mouse	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of RASIP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of RASIP1 mRNA	CTD	PMID:34911549
Rasip1	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of RASIP1 mRNA	CTD	PMID:17562736
Rasip1	Mouse	perfluorooctanoic acid	multiple interactions	ISO	Rasip1 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RASIP1 mRNA	CTD	PMID:35163327
Rasip1	Mouse	phenol red	multiple interactions	ISO	RASIP1 (Homo sapiens)	6480464	[Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of RASIP1 protein	CTD	PMID:31629898
Rasip1	Mouse	sodium arsenite	increases expression	ISO	RASIP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of RASIP1 mRNA	CTD	PMID:38568856
Rasip1	Mouse	sodium arsenite	affects expression	ISO	RASIP1 (Homo sapiens)	6480464	sodium arsenite affects the expression of RASIP1 mRNA	CTD	PMID:34032870
Rasip1	Mouse	sulfadimethoxine	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Sulfadimethoxine results in increased expression of RASIP1 mRNA	CTD	PMID:30047161
Rasip1	Mouse	sunitinib	increases expression	ISO	RASIP1 (Homo sapiens)	6480464	Sunitinib results in increased expression of RASIP1 mRNA	CTD	PMID:31533062
Rasip1	Mouse	tamoxifen	affects expression	EXP		6480464	Tamoxifen affects the expression of RASIP1 mRNA	CTD	PMID:17555576
Rasip1	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of RASIP1 gene	CTD	PMID:35295148
Rasip1	Mouse	trichloroethene	increases expression	ISO	Rasip1 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of RASIP1 mRNA	CTD	PMID:33387578
Rasip1	Mouse	trimellitic anhydride	decreases expression	EXP		6480464	trimellitic anhydride results in decreased expression of RASIP1 mRNA	CTD	PMID:19042947
Rasip1	Mouse	troglitazone	increases expression	EXP		6480464	troglitazone results in increased expression of RASIP1 mRNA	CTD	PMID:17569031
Rasip1	Mouse	vinclozolin	affects expression	ISO	Rasip1 (Rattus norvegicus)	6480464	vinclozolin affects the expression of RASIP1 mRNA	CTD	PMID:19015723
Rasip1	Mouse	vorinostat	decreases expression	ISO	RASIP1 (Homo sapiens)	6480464	vorinostat results in decreased expression of RASIP1 mRNA	CTD	PMID:27188386
Rasip1	Mouse	zinc atom	decreases expression	ISO	RASIP1 (Homo sapiens)	6480464	Zinc deficiency results in decreased expression of RASIP1 mRNA	CTD	PMID:18356318
Rasip1	Mouse	zinc(0)	decreases expression	ISO	RASIP1 (Homo sapiens)	6480464	Zinc deficiency results in decreased expression of RASIP1 mRNA	CTD	PMID:18356318

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rasip1	Mouse	angiogenesis	involved_in	IBA	PANTHER:PTN002699119 more ...	2290270		GO_Central	GO_REF:0000033
Rasip1	Mouse	angiogenesis	involved_in	IMP		2290270	PMID:19272373	UniProt	PMID:19272373
Rasip1	Mouse	branching morphogenesis of an epithelial tube	involved_in	IMP		2290270	PMID:21396893	UniProt	PMID:21396893
Rasip1	Mouse	negative regulation of autophagy	involved_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	negative regulation of autophagy	involved_in	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	negative regulation of membrane permeability	involved_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	negative regulation of membrane permeability	involved_in	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	negative regulation of Rho protein signal transduction	involved_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	negative regulation of Rho protein signal transduction	involved_in	IBA	PANTHER:PTN002699119 and UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000033
Rasip1	Mouse	negative regulation of Rho protein signal transduction	involved_in	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	negative regulation of Rho-dependent protein serine/threonine kinase activity	involved_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	positive regulation of cell population proliferation	acts_upstream_of_or_within	ISO	EMBL:AY378097	2290270	PMID:15031288	MGI	PMID:15031288
Rasip1	Mouse	positive regulation of integrin activation	involved_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	positive regulation of integrin activation	involved_in	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	signal transduction	involved_in	IEA	InterPro:IPR000159	2290270		InterPro	GO_REF:0000002
Rasip1	Mouse	vasculogenesis	involved_in	IMP		2290270	PMID:21396893	UniProt	PMID:21396893

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rasip1	Mouse	cell-cell junction	located_in	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	cell-cell junction	is_active_in	IBA	PANTHER:PTN002699119 and UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000033
Rasip1	Mouse	cell-cell junction	located_in	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	Golgi apparatus	located_in	ISO	EMBL:AY378097	2290270	PMID:15031288	MGI	PMID:15031288
Rasip1	Mouse	Golgi stack	located_in	IEA	UniProtKB-SubCell:SL-0135	2290270		UniProt	GO_REF:0000044
Rasip1	Mouse	perinuclear region of cytoplasm	located_in	ISO	EMBL:AY378097	2290270	PMID:15031288	MGI	PMID:15031288
Rasip1	Mouse	protein-containing complex	part_of	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	protein-containing complex	part_of	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rasip1	Mouse	GTPase binding	enables	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	GTPase binding	enables	IBA	PANTHER:PTN000411192 and UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000033
Rasip1	Mouse	protein binding	enables	IPI	UniProtKB:Q8CGF1 and UniProtKB:Q8VDD5	2290270	PMID:21396893	UniProt	PMID:21396893
Rasip1	Mouse	protein homodimerization activity	enables	IEA	UniProtKB:Q5U651 and ensembl:ENSP00000222145	2290270		Ensembl	GO_REF:0000107
Rasip1	Mouse	protein homodimerization activity	enables	ISO	UniProtKB:Q5U651	2290270		GO_Central	GO_REF:0000119
Rasip1	Mouse	small GTPase binding	enables	ISO	EMBL:AY378097	2290270	PMID:15031288	MGI	PMID:15031288

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rasip1	Mouse	abnormal allantois morphology		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal cardiovascular development		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal dorsal aorta morphology		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal dorsal aorta morphology		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	abnormal endocardium morphology		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vascular development		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vascular endothelial cell development		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vascular endothelial cell differentiation		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vascular endothelial cell morphology		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	abnormal vasculogenesis		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vitelline vascular remodeling		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	abnormal vitelline vascular remodeling		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	abnormal vitelline vasculature morphology		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	decreased embryo size		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	dilated dorsal aorta		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	edema		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	edema		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	embryonic growth retardation		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	embryonic lethality during organogenesis, complete penetrance		IAGP		5509061		MGI	PMID:21396893
Rasip1	Mouse	embryonic lethality during organogenesis, complete penetrance		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	hemorrhage		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	pallor		IAGP		5509061		MGI	PMID:23886837
Rasip1	Mouse	pericardial edema		IAGP		5509061		MGI	PMID:23886837

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Database resources of the National Center for Biotechnology Information.	Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12644598	PMID:14610273	PMID:15031288	PMID:15489334	PMID:16141072	PMID:16141073	PMID:18483404
PMID:19272373	PMID:21267068	PMID:21396893	PMID:21677750	PMID:21873635	PMID:22076636	PMID:23886837	PMID:24622510	PMID:26002917	PMID:26897025	PMID:27486147	PMID:27789228
PMID:29669786	PMID:30042182	PMID:31112136

Rasip1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	45,276,961 - 45,288,516 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	45,276,912 - 45,288,517 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,627,537 - 45,639,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,627,488 - 45,639,093 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,882,907 - 52,894,462 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	45,495,579 - 45,507,134 (+)	NCBI		MGSCv36	mm8
Celera	7	41,089,079 - 41,100,635 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.39	NCBI

RASIP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	48,720,585 - 48,740,610 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	48,720,585 - 48,740,610 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	49,223,842 - 49,243,867 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	53,915,654 - 53,935,782 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	53,915,653 - 53,935,782	NCBI
Celera	19	46,089,934 - 46,110,062 (-)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	45,603,007 - 45,622,781 (-)	NCBI		HuRef
CHM1_1	19	49,225,580 - 49,245,732 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	51,715,002 - 51,735,029 (-)	NCBI		T2T-CHM13v2.0

Rasip1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	105,233,599 - 105,246,028 (+)	NCBI		GRCr8
mRatBN7.2	1	96,097,135 - 96,109,564 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	96,091,074 - 96,109,562 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,482,573 - 101,495,002 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,955,274 - 109,967,703 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	103,245,644 - 103,258,074 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,609,209 - 101,621,648 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,610,773 - 101,621,646 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,687,843 - 102,700,428 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	96,097,668 - 96,108,543 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	96,174,114 - 96,186,654 (+)	NCBI
Celera	1	90,352,345 - 90,363,220 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

Rasip1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,831,123 - 1,843,905 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,830,574 - 1,844,107 (+)	NCBI	ChiLan1.0	ChiLan1.0

RASIP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	54,823,848 - 54,843,803 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	56,750,190 - 56,770,147 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	45,720,179 - 45,740,131 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	54,311,649 - 54,318,585 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

RASIP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	107,583,169 - 107,597,683 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	107,581,424 - 107,597,682 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	107,105,550 - 107,119,765 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	108,107,785 - 108,121,968 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	108,107,111 - 108,121,992 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,774,623 - 107,788,818 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	107,421,540 - 107,435,931 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	108,257,120 - 108,271,542 (+)	NCBI		UU_Cfam_GSD_1.0

Rasip1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,125,378 - 21,137,442 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	2,743,564 - 2,754,395 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	2,743,568 - 2,754,618 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RASIP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,058,759 - 54,072,459 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	54,058,748 - 54,072,415 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	49,806,097 - 49,819,876 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RASIP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	41,970,704 - 41,997,951 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	41,991,176 - 41,996,155 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	21,840,051 - 21,860,422 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rasip1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	5,177,092 - 5,189,471 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	5,176,697 - 5,189,673 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rasip1
742 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	262
Count of miRNA genes:	218
Interacting mature miRNAs:	239
Transcripts:	ENSMUST00000057927
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25314307	Mlh1fc2_m	MLH1 foci count 2 (mouse)					7	6502999	133501729	Mouse
4141566	Femwf8_m	femur work to failure 8 (mouse)			Not determined			13032485	47032621	Mouse
1301969	Lbw5_m	lupus NZB x NZW 5 (mouse)			Not determined		7	26847615	60851775	Mouse
38501071	Stsl6_m	Salmonella typhimurium susceptibility locus 6 (mouse)					7	34199425	51149748	Mouse
1357586	Mdmsc3_m	modifier of muscularity 3 (mouse)			Not determined		7	34447869	68448018	Mouse
38501068	Tip1_m	tuberculosis immunophenotype 1, spleen CFU (mouse)					7	3602999	72549748	Mouse
39128210	Lwq19_m	liver weight QTL 19 (mouse)					7	33497727	58148965	Mouse
11252140	Fdr1_m	fat response to dietary restriction 1 (mouse)					7	41148820	75148965	Mouse
25314314	Sccor1_m	synaptonemal complex length to mean MLH1 count ratio 1 (mouse)					7	13333925	47349748	Mouse
1357469	Kidq5_m	kidney weight QTL 5 (mouse)			Not determined		7	33497727	58148965	Mouse
1301082	Bbaa16_m	B.burgdorferi-associated arthritis 16 (mouse)			Not determined		7	36280015	116416877	Mouse
4142003	W3q10_m	weight 3 weeks QTL 10 (mouse)			Not determined			33497727	58148965	Mouse
12790989	Tgl6_m	triglyceride 6 (mouse)					7	27540549	61540549	Mouse
1559000	Ossc1_m	osteosarcoma susceptibility 1 (mouse)			Not determined		7	34053025	68053223	Mouse
10043926	Bw1n_m	body weight 1 in NSY (mouse)			Not determined		7	45161966	118693530	Mouse
11522751	Cocia17_m	cocaine-induced activity, QTL 17 (mouse)					7	13135204	47135204	Mouse
12792978	Fbmd3_m	femoral bone mineral density 3, females only (mouse)					7	7050288	142367832	Mouse
4141805	Sle19_m	systematic lupus erythematosus susceptibility 19 (mouse)			Not determined			30032485	81135653	Mouse
1357634	Splq7_m	spleen weight QTL 7 (mouse)			Not determined		7	33497727	58148965	Mouse
4141929	Chlq18_m	circulating hormone level QTL 18 (mouse)			Not determined		7	41148820	75148965	Mouse
1300996	Aorls2_m	aortic lesion size 2 (mouse)			Not determined		7	32394532	66394681	Mouse
10449158	Eosn3_m	eosinophil differential 3 (mouse)					7	12480877	46480877	Mouse
1301514	Rigs1_m	radiation induced gastroschisis 1 (mouse)			Not determined		7	36280015	92394346	Mouse
1300878	Skts1_m	skin tumor susceptibility 1 (mouse)			Not determined		7	37891386	71891582	Mouse
1301709	Bdt4_m	bone density traits 4 (mouse)			Not determined		7	22888572	56888716	Mouse
1300722	Sle3_m	systemic lupus erythmatosus susceptibility 3 (mouse)			Not determined		7	3511728	87142720	Mouse
12904742	Litsq2_m	litter size QTL 2 (mouse)					7	22673887	56674033	Mouse
1301175	Ap7q_m	alcohol preference 7 QTL (mouse)			Not determined		7	31714845	65715077	Mouse
1300791	Abbp3_m	A/J and C57BL/6 blood pressure 3 (mouse)			Not determined		7	39673887	103510010	Mouse
1301622	Eae12_m	susceptibility to experimental allergic encephalomyelitis 12 (mouse)			Not determined		7	19280015	53280104	Mouse
11354952	Pdcc1_m	plasmacytoid dentritic cell compartment 1 (mouse)					7	23066531	57066531	Mouse
12880417	V125Dq5_m	vitamin D active form serum level QTL 5 (mouse)					7	45249748	79249748	Mouse
10402488	Dipa2_m	drug induced psychomotor activation 2 (mouse)			Not determined		7	38421548	72421684	Mouse
4142102	Tailq5_m	tail length QTL 5 (mouse)			Not determined			33497727	58148965	Mouse
4141909	W10q18_m	weight 10 weeks QTL 18 (mouse)			Not determined			33497727	58148965	Mouse
10449139	Eosn1_m	eosinophil differential 1 (mouse)					7	12480877	46480877	Mouse
26884404	Huml1_m	humerus length 1, 5 week (mouse)					7	30199425	108999207	Mouse
1301052	Bhr6_m	bronchial hyperresponsiveness 6 (mouse)			Not determined		7	19842250	53842367	Mouse
1357883	Epfq5_m	epididymal fat pad weight QTL 5 (mouse)			Not determined		7	33497727	58148965	Mouse
10045622	Heal20_m	wound healing/regeneration 20 (mouse)			Not determined		7	34316887	68317043	Mouse
1301158	Eae4_m	susceptibility to experimental allergic encephalomyelitis 4 (mouse)			Not determined		7	19147398	141919804	Mouse
4142218	W6q17_m	weight 6 weeks QTL 17 (mouse)			Not determined			33497727	58148965	Mouse
10412199	Sst2_m	susceptibility to tuberculosis 2 (mouse)			Not determined		7	18728794	119485380	Mouse
25314303	Vmm4_m	variable multisystem mineralization 4, kidney (mouse)					7	37299425	87049208	Mouse
1559016	Drsi_m	DCC-related Spp1 induction (mouse)			Not determined		7	16637293	49159331	Mouse
25314301	Vmm3_m	variable multisystem mineralization 3, lung (mouse)					7	37299425	72049748	Mouse

AI853551

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	45,638,874 - 45,638,970	UniSTS	GRCm38
MGSCv37	7	52,894,244 - 52,894,340	UniSTS	GRCm37
Celera	7	41,100,417 - 41,100,513	UniSTS
Cytogenetic Map	7	B2	UniSTS
Cytogenetic Map	7	B4	UniSTS
Whitehead/MRC_RH	7	566.14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_028544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC149057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK011557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK033276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK156602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BB646451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC028444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC028483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC150766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU054468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO039349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000057927 ⟹ ENSMUSP00000062429

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	45,276,912 - 45,288,517 (+)	Ensembl
GRCm38.p6 Ensembl	7	45,627,488 - 45,639,093 (+)	Ensembl

RefSeq Acc Id:

NM_028544 ⟹ NP_082820

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	7	45,276,961 - 45,288,516 (+)	NCBI
GRCm38	7	45,627,537 - 45,639,092 (+)	NCBI
MGSCv37	7	52,882,907 - 52,894,462 (+)	RGD
Celera	7	41,089,079 - 41,100,635 (+)	RGD
cM Map	7		ENTREZGENE

Sequence:

show sequence

TTAACGGAGGCCAACAGCACCAGGGCCTCCGGGTGCTACGGGACCCGAAGCAGGGGCCATGCTATCTGGTGAACGAAAGGAGGGCGGAAGCCCCCGCTTCGGGAAGCTCCATCTTCCAGTGGGCCTGT
GGATCAATTCCCCAAGGAAACAGCTCGCCAAACTGGGGCGGCGCTGGCCCAGCGCTGCCTCTGTCAAGTCCTCGTCCTCCGACACGGGGAGCCGAAGCAGCGAGCCCCTGCCGCCGCCGCCGCCGCCG
CCGCACGTGGAGCTGCGGCGCGTAGGTGCGGTGAAGGCGGCGGGGGGAGCGTCGGGCAGCCGAGCCAAGCGCATCTCGCAGCTGTTTCGGGGCTCAGGGGCCGGCGGCGCCGGGGGTCCTGGCACGCC
TGGGGGCGCGCAGCGCTGGGCCAGCGAGAAGAAGCTGCCTGAACTGGCGGCGGGTGTAGCTCCGGAGCCCCCGTTGCCCACGCGTGCCGCGGTGCCCCCGGGAGTGCTCAAGATCTTCGCTTCTGGGC
TGGCGTCGGGCGCCAACTACAAGAGCGTGCTGGCTACGGAGCGATCCACCGCGCGCGAGCTGGTGGCGGAGGCGCTGGAGCGCTACGGGCTGACGGGCGGCCGCGGAGCGGGCGACAGCGGCTGCGTG
GACGCCTACGCGCTTTGCGACGCTCTGGGCCGGCCCGCGGTCGGCGTGGGCGGAGGCGAGTGGCGTGCCGAGCACCTGCGGGTGTTGGCCGACGCGGAGCGCCCTCTGCTGGTGCAGGACCTGTGGCG
CGCCCGTCCGGGCTGGGCGCGGCGCTTTGAGCTGCGCGGCCGCGAGGAGGCTCGACGGCTGGAGCAGGAGGCCTTCGGGGCTGCGGATGCAGACGGCACAAACGCCCCATCTTGGCGGACCCAGAAGA
ATAGGTCTCGGGCAGCATCTGGCGGGGCAGCTCTGGCCAGTCCTGGTCCAGGATCAGGATCCGGGACCCCCACTGGGTCCGGGGGCAAGGAGCGATCTGAAAATTTGTCTCTGCGTCGAAGCGTGTCT
GAGCTGAGTCTACAGGGGCGGAGGCGAAGGCAGCAGGAACGCAGGCAGCAGGCCCTTAGCATGGCCCCAGGGGCAGCTGATGCTCAGATGGTACCAACGGACCCTGGAGACTTCGATCAGTTGACTCA
GTGCCTCATTCAGGCACCCAGCAACCGTCCCTACTTCCTTCTGCTCCAGGGCTACCAGGATGCTCAGGACTTCGTGGTGTATGTCATGACACGAGAGCAGCACGTGTTCGGCCGGGGTGGGCCCTCCT
CGTCCCGCGGGGGATCCCCAGCCCCATATGTGGACACCTTCCTCAACGCCCCAGACATCCTGCCTCGACATTGCACGGTGCGCGCGGGCCCTGAGCCCCCGGCCATGGTGCGCCCATCCCGGGGCGCC
CCCGTCACACACAATGGCTGTCTTTTGCTGCGGGAGGCAGAGCTGCACCCCGGAGACCTGTTAGGCCTAGGAGAGCATTTCCTGTTCATGTACAAGGACCCCCGCTCCGGGGGTTCTGGGCCCGCTCG
GCCATCTTGGCTGCCAGCGCGCCCCGGGGCCGCGCCACCCGGACCGGGCTGGGCCTTTTCTTGTCGTTTGTGTGGCCGTGGCCTGCAGGAGCGCGGCGAGGCGCTGGCCGCCTACCTGGATGGCCGCG
AGCCGGTGCTGCGGTTCAGACCACGAGAGGAAGAGGCGCTGTTGGGCGAGATCGTGCGAGCTGCAGCCTCGGGAGCAGGGGACCTGCCCCCGCTCGGGCCAGCCACTCTGCTGGCACTGTGTGTGCAG
CATTCTGCGAGGGAGCTGGAGCTGGGCCACCTGCCTCGCTTGCTGGGCCGCCTGGCCCGGCTCATCAAAGAAGCCGTTTGGGAAAAAATTAAAGAAATTGGAGACCGCCAGCCAGAGAACCACCCAGA
GGGAGTTCCCGAGGTGCCTCTGACCCCTGAGGCTGTGTCTGTGGAGCTGCGACCACTCATACTATGGATGGCCAACACCACAGAGCTGTTGAGCTTTGTACAGGAGAAAGTGCTAGAGATGGAGAAGG
AGGCTGACCAGGAGGGCCTGTCCTCGGACCCACAGCTCTGCAATGACTTGGAACTGTGTGATGAGGCCTTGGCCCTCCTGGATGAGGTCATCATGTGTACTTTCCAGCAGTCGGTCTACTACCTCACC
AAGACTCTTTATTCAACACTGCCAGCTCTCCTGGACAGTAACCCTTTCACAGCTGGAGCAGAGCTGCCAGGGCCTGGCGCAGAGCTGGAGGCCATGCCGCCTGGGCTCAGGCCTACTCTGGGTGTGTT
CCAGGCAGCTCTAGAACTGACCAGTCAGTGTGAGCTGCATCCCGACCTCGTGTCCCAGACTTTTGGCTATTTGTTCTTCTTCTCCAATGCATCCCTTCTCAACTCACTGATGGAACGAGGTCAAGGCC
GACCTTTCTATCAATGGTCTCGAGCCGTCCAAATCAGAACCAACTTGGATCTTGTGTTGGATTGGCTTCAGGGGGCCGGGCTGGGTGACATTGCCACTGAGTTCTTCCGGAAACTTTCCATTGCTGTG
AACCTGCTATGTGTGCCCCGCACCTCCCTGCTCAAGGCTTCATGGAGCAGCTTACGGACTGACTACCCCACCCTGACTCCAGCTCAGCTCCACCATCTCCTCAGCCACTACCAGTTGGGTCCTGGCCG
TGGTCCCCCACCAGCCTGGGACCCACCACCTGCAGAGCGGGATGCTGTGGACACAGGGGATATCTTTGAAAGTTTTTCCTCGCACCCTCCGCTCATCCTGCCCCTGGGCAGCTCACGCCTGCGCCTCA
CCGGCCCTGTGACAGATGACGCATTGCATAGAGAACTGCGCAGGCTCCGTCGCCTCCTCTGGGATCTTGAACAGCAGGAGCTGCCAGCCAATCATCGCCATGGACCCCCGGTGGCTTCGACACCTTGA
AAACCAATGAGAAAGGAACGCGCGCAGCTTGAAACTGCATCGCTTCTTAAAAGGGAGCCCGCCTGGGCGTAGAGCATTTTGGGAGTTGTAGTTTTCCCTGCGTAGACGGCTGAGAGTTTGAGTTGTTG
GGTTGGTAGACGATGGGACAGTGGGAAGATGGGCTTGGGATGTGAATGCCAAGAAGTAATAAAAATATCTGTGGTATTGAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_082820	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH28444	(Get FASTA)	NCBI Sequence Viewer
	AAH72584	(Get FASTA)	NCBI Sequence Viewer
	AAI27060	(Get FASTA)	NCBI Sequence Viewer
	AAI50767	(Get FASTA)	NCBI Sequence Viewer
	BAB27695	(Get FASTA)	NCBI Sequence Viewer
	BAC28217	(Get FASTA)	NCBI Sequence Viewer
	BAE33775	(Get FASTA)	NCBI Sequence Viewer
	EDL22879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000062429
	ENSMUSP00000062429.8
GenBank Protein	Q3U0S6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_082820 ⟸ NM_028544

- UniProtKB:

E9QLI7 (UniProtKB/Swiss-Prot), Q6GQW4 (UniProtKB/Swiss-Prot), Q3U0S6 (UniProtKB/Swiss-Prot), B9EK92 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPLPPPPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGAGGAGGPGTPGGAQRWASEKKLPELAAGV
APEPPLPTRAAVPPGVLKIFASGLASGANYKSVLATERSTARELVAEALERYGLTGGRGAGDSGCVDAYALCDALGRPAVGVGGGEWRAEHLRVLADAERPLLVQDLWRARPGWARRFELRGREEARR
LEQEAFGAADADGTNAPSWRTQKNRSRAASGGAALASPGPGSGSGTPTGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQMVPTDPGDFDQLTQCLIQAPSNRPYFLLLQGYQ
DAQDFVVYVMTREQHVFGRGGPSSSRGGSPAPYVDTFLNAPDILPRHCTVRAGPEPPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDPRSGGSGPARPSWLPARPGAAPPGPGWAF
SCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEIVRAAASGAGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPL
ILWMANTTELLSFVQEKVLEMEKEADQEGLSSDPQLCNDLELCDEALALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELEAMPPGLRPTLGVFQAALELTSQCELHPDLVSQ
TFGYLFFFSNASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSIAVNLLCVPRTSLLKASWSSLRTDYPTLTPAQLHHLLSHYQLGPGRGPPPAWDPPPAERDAVDTG
DIFESFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANHRHGPPVASTP

hide sequence

Ensembl Acc Id:

ENSMUSP00000062429 ⟸ ENSMUST00000057927

Protein Domains

Dilute Ras-associating

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3U0S6-F1-model_v2	AlphaFold	Q3U0S6	1-961	view protein structure

RGD ID:

8664059

Promoter ID:

EPDNEW_M10061

Type:

initiation region

Name:

Rasip1_1

Description:

Mus musculus Ras interacting protein 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	45,627,516 - 45,627,576	EPDNEW

RGD ID:

6841905

Promoter ID:

MM_KWN:50436

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain, Kidney, Lung

Transcripts:

OTTMUST00000073119, OTTMUST00000073120

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	52,882,736 - 52,883,236 (+)	MPROMDB

RGD ID:

6849236

Promoter ID:

MM_XEF:6552

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, Spleen

Transcripts:

NM_001106261

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	52,884,016 - 52,884,516 (+)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000044562	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000057927	ENTREZGENE
	ENSMUST00000057927.10	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.200.20	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
InterPro	CBD_Rasip1/Radil	UniProtKB/Swiss-Prot
	Dilute_dom	UniProtKB/Swiss-Prot
	RA_dom	UniProtKB/Swiss-Prot
	SMAD_FHA_dom_sf	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Vascular_dev_regulator	UniProtKB/Swiss-Prot
KEGG Report	mmu:69903	UniProtKB/Swiss-Prot
MGD	MGI:1917153	ENTREZGENE
NCBI Gene	69903	ENTREZGENE
PANTHER	DILUTE DOMAIN-CONTAINING PROTEIN YPR089W	UniProtKB/Swiss-Prot
	RAS-INTERACTING PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	DIL	UniProtKB/Swiss-Prot
	PF00788	UniProtKB/Swiss-Prot
PhenoGen	Rasip1	PhenoGen
PROSITE	DILUTE	UniProtKB/Swiss-Prot
	PS50200	UniProtKB/Swiss-Prot
SMART	DIL	UniProtKB/Swiss-Prot
	SM00314	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49879	UniProtKB/Swiss-Prot
	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0JNY4_MOUSE	UniProtKB/TrEMBL
	B9EK92	ENTREZGENE, UniProtKB/TrEMBL
	E9QLI7	ENTREZGENE
	Q3U0S6	ENTREZGENE
	Q6GQW4	ENTREZGENE
	Q8CCF1_MOUSE	UniProtKB/TrEMBL
	Q8R2L4_MOUSE	UniProtKB/TrEMBL
	Q9D0D0_MOUSE	UniProtKB/TrEMBL
	RAIN_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	E9QLI7	UniProtKB/Swiss-Prot
	Q6GQW4	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype