Symbol: |
Cstb |
Name: |
cystatin B |
RGD ID: |
8886265 |
Description: |
ENCODES a protein that exhibits cysteine-type endopeptidase inhibitor activity (ortholog); endopeptidase inhibitor activity (ortholog); protease binding (ortholog); INVOLVED IN adult locomotory behavior (ortholog); amyloid fibril formation (ortholog); negative regulation of proteolysis (ortholog); ASSOCIATED WITH autistic disorder (ortholog); benign epilepsy with centrotemporal spikes (ortholog); cataract 9 multiple types (ortholog); FOUND IN cytoplasm (ortholog); cytosol (ortholog); extracellular space (ortholog) |
Type: |
protein-coding
|
RefSeq Status: |
MODEL |
Previously known as: |
cystatin B (stefin B); cystatin-B |
RGD Orthologs |
|
Alliance Orthologs |
|
More Info |
more info ...
|
More Info |
Species |
Gene symbol and name |
Data Source |
Assertion derived from |
less info ...
|
Orthologs 1 |
Homo sapiens (human): |
CSTB (cystatin B) |
NCBI |
Ortholog |
Mus musculus (house mouse): |
Cstb (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Rattus norvegicus (Norway rat): |
Cstb (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Pan paniscus (bonobo/pygmy chimpanzee): |
CSTB (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Canis lupus familiaris (dog): |
CSTB (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Ictidomys tridecemlineatus (thirteen-lined ground squirrel): |
Cstb (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Sus scrofa (pig): |
CSTB (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Chlorocebus sabaeus (green monkey): |
CSTB (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Heterocephalus glaber (naked mole-rat): |
Cstb (cystatin B) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
|
Latest Assembly: |
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly |
NCBI Annotation Information: |
Annotation category: partial on reference assembly |
Position: |
Chinchilla Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChiLan1.0 Ensembl | NW_004955407 | 41,475,533 - 41,479,150 (+) | Ensembl | ChiLan1.0 | | | | ChiLan1.0 | NW_004955407 | 41,475,533 - 41,478,943 (+) | NCBI | ChiLan1.0 | ChiLan1.0 | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
Cstb (Chinchilla lanigera - long-tailed chinchilla) |
Chinchilla Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChiLan1.0 Ensembl | NW_004955407 | 41,475,533 - 41,479,150 (+) | Ensembl | ChiLan1.0 | | | | ChiLan1.0 | NW_004955407 | 41,475,533 - 41,478,943 (+) | NCBI | ChiLan1.0 | ChiLan1.0 | | |
|
CSTB (Homo sapiens - human) |
Human Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCh38 | 21 | 43,773,950 - 43,776,308 (-) | NCBI | GRCh38 | GRCh38 | hg38 | GRCh38 | GRCh38.p14 Ensembl | 21 | 43,772,511 - 43,776,330 (-) | Ensembl | GRCh38 | | hg38 | GRCh38 | GRCh37 | 21 | 45,193,831 - 45,196,189 (-) | NCBI | GRCh37 | GRCh37 | hg19 | GRCh37 | Build 36 | 21 | 44,018,259 - 44,020,687 (-) | NCBI | NCBI36 | Build 36 | hg18 | NCBI36 | Build 34 | 21 | 44,018,259 - 44,020,687 | NCBI | | | | | Celera | 21 | 30,299,423 - 30,301,851 (-) | NCBI | | Celera | | | Cytogenetic Map | 21 | q22.3 | NCBI | | | | | HuRef | 21 | 30,561,944 - 30,564,654 (-) | NCBI | | HuRef | | | CHM1_1 | 21 | 44,754,030 - 44,756,740 (-) | NCBI | | CHM1_1 | | | T2T-CHM13v2.0 | 21 | 42,129,562 - 42,131,920 (-) | NCBI | | T2T-CHM13v2.0 | | |
|
Cstb (Mus musculus - house mouse) |
Mouse Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCm39 | 10 | 78,261,504 - 78,263,456 (+) | NCBI | GRCm39 | GRCm39 | mm39 | | GRCm39 Ensembl | 10 | 78,261,503 - 78,263,456 (+) | Ensembl | | GRCm39 Ensembl | | | GRCm38 | 10 | 78,425,670 - 78,427,622 (+) | NCBI | GRCm38 | GRCm38 | mm10 | GRCm38 | GRCm38.p6 Ensembl | 10 | 78,425,669 - 78,427,622 (+) | Ensembl | GRCm38 | | mm10 | GRCm38 | MGSCv37 | 10 | 77,888,415 - 77,890,367 (+) | NCBI | GRCm37 | MGSCv37 | mm9 | NCBIm37 | MGSCv36 | 10 | 77,828,799 - 77,830,751 (+) | NCBI | | MGSCv36 | mm8 | | Celera | 10 | 79,447,767 - 79,449,719 (+) | NCBI | | Celera | | | Cytogenetic Map | 10 | C1 | NCBI | | | | | cM Map | 10 | 39.72 | NCBI | | | | |
|
Cstb (Rattus norvegicus - Norway rat) |
Rat Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCr8 | 20 | 10,245,157 - 10,247,199 (-) | NCBI | | GRCr8 | | | mRatBN7.2 | 20 | 10,245,462 - 10,247,505 (-) | NCBI | mRatBN7.2 | mRatBN7.2 | | | mRatBN7.2 Ensembl | 20 | 10,245,462 - 10,247,526 (-) | Ensembl | | mRatBN7.2 Ensembl | | | UTH_Rnor_SHR_Utx | 20 | 10,945,142 - 10,947,182 (-) | NCBI | Rnor_SHR | UTH_Rnor_SHR_Utx | | | UTH_Rnor_SHRSP_BbbUtx_1.0 | 20 | 10,306,047 - 10,308,087 (-) | NCBI | Rnor_SHRSP | UTH_Rnor_SHRSP_BbbUtx_1.0 | | | UTH_Rnor_WKY_Bbb_1.0 | 20 | 10,777,526 - 10,779,568 (-) | NCBI | Rnor_WKY | UTH_Rnor_WKY_Bbb_1.0 | | | Rnor_6.0 | 20 | 10,966,357 - 10,968,399 (-) | NCBI | Rnor6.0 | Rnor_6.0 | rn6 | Rnor6.0 | Rnor_6.0 Ensembl | 20 | 10,966,331 - 10,968,432 (-) | Ensembl | Rnor6.0 | | rn6 | Rnor6.0 | Rnor_5.0 | 20 | 13,137,896 - 13,139,938 (-) | NCBI | Rnor5.0 | Rnor_5.0 | rn5 | Rnor5.0 | RGSC_v3.4 | 20 | 10,576,664 - 10,578,706 (-) | NCBI | RGSC3.4 | RGSC_v3.4 | rn4 | RGSC3.4 | RGSC_v3.1 | 20 | 10,576,891 - 10,578,923 (-) | NCBI | | | | | Celera | 20 | 11,756,111 - 11,758,153 (-) | NCBI | | Celera | | | Cytogenetic Map | 20 | p12 | NCBI | | | | |
|
CSTB (Pan paniscus - bonobo/pygmy chimpanzee) |
Bonobo Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
NHGRI_mPanPan1-v2 | 22 | 39,780,301 - 39,783,181 (-) | NCBI | | NHGRI_mPanPan1-v2 | | | NHGRI_mPanPan1 | 21 | 34,630,903 - 34,633,448 (-) | NCBI | | NHGRI_mPanPan1 | | | Mhudiblu_PPA_v0 | 21 | 30,030,359 - 30,032,899 (-) | NCBI | Mhudiblu_PPA_v0 | Mhudiblu_PPA_v0 | panPan3 | | PanPan1.1 | 21 | 43,329,002 - 43,343,874 (-) | NCBI | panpan1.1 | PanPan1.1 | panPan2 | |
|
CSTB (Canis lupus familiaris - dog) |
Dog Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
Dog10K_Boxer_Tasha | 31 | 36,873,130 - 36,876,156 (-) | NCBI | | Dog10K_Boxer_Tasha | | | ROS_Cfam_1.0 | 31 | 37,261,684 - 37,264,733 (-) | NCBI | | ROS_Cfam_1.0 | | | ROS_Cfam_1.0 Ensembl | 31 | 37,261,716 - 37,264,743 (-) | Ensembl | | ROS_Cfam_1.0 Ensembl | | | UMICH_Zoey_3.1 | 31 | 37,129,434 - 37,132,462 (-) | NCBI | | UMICH_Zoey_3.1 | | | UNSW_CanFamBas_1.0 | 31 | 37,115,288 - 37,118,267 (-) | NCBI | | UNSW_CanFamBas_1.0 | | | UU_Cfam_GSD_1.0 | 31 | 37,607,453 - 37,610,501 (-) | NCBI | | UU_Cfam_GSD_1.0 | | |
|
Cstb (Ictidomys tridecemlineatus - thirteen-lined ground squirrel) |
|
CSTB (Sus scrofa - pig) |
|
CSTB (Chlorocebus sabaeus - green monkey) |
|
Cstb (Heterocephalus glaber - naked mole-rat) |
|
.
Ensembl Acc Id: |
ENSCLAT00000014610 ⟹ ENSCLAP00000014452 |
Type: |
CODING |
Position: |
Chinchilla Assembly | Chr | Position (strand) | Source |
---|
ChiLan1.0 Ensembl | NW_004955407 | 41,475,533 - 41,479,150 (+) | Ensembl |
|
RefSeq Acc Id: |
XM_005375884 ⟹ XP_005375941 |
Type: |
CODING |
Position: |
Chinchilla Assembly | Chr | Position (strand) | Source |
---|
ChiLan1.0 | NW_004955407 | 41,475,533 - 41,478,943 (+) | NCBI |
|
Sequence: |
GCCGGGTACTACCCGAGCACCGACCGCGGCGCTGCGCGCGCATGCGCGTTTGTGCGTGCCGGTGCGTGCGCATGCGTCCGTGCGTCCGGGCCCAGGAGCCGGCGCCAACTTCCGGCAGGGCGGGACCG CGCCCCCGCGCCGTGGCCCGGGCCGCCCCGTGGCCCCGCCCGCGTCACGAGGCCGCGGAGCATAAACGCTGTGATTGCGGCGCCCAGCACCGCAGTGCAGCCCGCGACGCCCCAGCCCGCCGCCAGGA TGATGTGCGGCGCGCCCTCCGCCACGCAGCCGGCCACGGCCGAGACGCAGGAGCTCGCGGACGCGGTGCGGGCCCAGCTCGAAGAGAAGGAGAACCAGAAGTTCTCAGTGTTCAAGGCCGTGGCCTTC AGGTGCCAGGTGGTGGCCGGGACCAACTACTTCATCAAGGTGGACACTGGGGACGAGAACTTCCTGCATTTGCGGGTGTTCAAGAGCCTCCCGCATGAGAACAAGCCCCTGGTCCTGGCCGGCTACCA GACCAGCAAGTCCAGGCACGACGAGCTGGCCTACTTCTAGCCCTATGCCTCTGCCACCCTCTGTCATCTGCAAGCCTGTGTTCGGGACCACGGCGTAAATCGTCCTGTTGGGCCGCTCAGCCGCGTGG AGCAGCTTCTCACACTGTGGCTCCAGAATGTCTTTGTGTGATTTTCCCTCCCAACGAGTGATCGTAACTGTTTCCAAGAGGCCTCTATGTGATCTACCTTTAAAGGTCTATTTTTGAAGTCTTTACTG A
hide sequence
|
RefSeq Acc Id: |
XP_005375941 ⟸ XM_005375884 |
- UniProtKB: |
A0A8C2VLR8 (UniProtKB/TrEMBL) |
- Sequence: |
MMCGAPSATQPATAETQELADAVRAQLEEKENQKFSVFKAVAFRCQVVAGTNYFIKVDTGDENFLHLRVFKSLPHENKPLVLAGYQTSKSRHDELAYF
hide sequence
|
|
Ensembl Acc Id: |
ENSCLAP00000014452 ⟸ ENSCLAT00000014610 |
|
Date |
Current Symbol |
Current Name |
Previous Symbol |
Previous Name |
Description |
Reference |
Status |
2016-08-16 |
Cstb |
cystatin B |
|
cystatin B (stefin B) |
Symbol and/or name change |
5135510 |
APPROVED |
|
|