Cstb (cystatin B) - Rat Genome Database

Name: Cstb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cstb (cystatin B) Rattus norvegicus

Analyze

Symbol:

Cstb

Name:

cystatin B

RGD ID:

2435

Description:

Predicted to enable cysteine-type endopeptidase inhibitor activity and protease binding activity. Predicted to be involved in amyloid fibril formation and negative regulation of peptidase activity. Predicted to act upstream of or within adult locomotory behavior. Predicted to be located in cytoplasm; extracellular space; and nucleolus. Predicted to be active in cytosol. Biomarker of visual epilepsy. Human ortholog(s) of this gene implicated in Unverricht-Lundborg syndrome and progressive myoclonus epilepsy 1A. Orthologous to human CSTB (cystatin B); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CYB; cystatin B (stefin B); Cystatin beta; cystatin-B; cystatin-beta; EPM1; liver thiol proteinase inhibitor; MGC105499; stefin-B; Stfb

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CSTB (cystatin B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cstb (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cstb (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CSTB (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CSTB (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cstb (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CSTB (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CSTB (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cstb (cystatin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cstb (cystatin B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CSTB (cystatin B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cst14a.1 (cystatin 14a, tandem duplicate 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	cst14b.2 (cystatin 14b, tandem duplicate 2)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	cst14b.1 (cystatin 14b, tandem duplicate 1)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cst14a.2 (cystatin 14a, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	10,245,462 - 10,247,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,245,462 - 10,247,526 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	10,945,142 - 10,947,182 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,306,047 - 10,308,087 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	10,777,526 - 10,779,568 (-)	NCBI	Rnor_WKY
Rnor_6.0	20	10,966,357 - 10,968,399 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	10,966,331 - 10,968,432 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,137,896 - 13,139,938 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,576,664 - 10,578,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,576,891 - 10,578,923 (-)	NCBI
Celera	20	11,756,111 - 11,758,153 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

autoimmune polyendocrine syndrome type 1 (ISO)

benign epilepsy with centrotemporal spikes (ISO)

cataract 9 multiple types (ISO)

developmental and epileptic encephalopathy 30 (ISO)

Dyskinesias (ISO)

dystonia (ISO)

esophagus squamous cell carcinoma (ISO)

genetic disease (ISO)

glioblastoma (ISO)

homocystinuria (ISO)

intellectual disability (ISO)

leukocyte adhesion deficiency 1 (ISO)

meningioma (ISO)

microcephaly (ISO)

Myoclonic Epilepsies (ISO)

Neoplasm Invasiveness (ISO)

Neurodevelopmental Disorders (ISO)

primary ciliary dyskinesia (ISO)

progressive myoclonus epilepsy (ISO)

progressive myoclonus epilepsy 1A (ISO)

Recurrence (ISO)

Unverricht-Lundborg syndrome (ISO)

visual epilepsy (IEP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-nitrofluorene (EXP)

3',5'-cyclic AMP (EXP)

3,4-dichloroaniline (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

Allylamine (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

ATP (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chloropicrin (ISO)

choline (ISO)

ciglitazone (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

diazinon (EXP,ISO)

dibenzo[a,l]pyrene (ISO)

dieldrin (EXP)

diethylstilbestrol (EXP,ISO)

dioxygen (ISO)

diuron (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenamidone (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

genistein (ISO)

gentamycin (EXP)

griseofulvin (ISO)

isoflurane (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methapyrilene (EXP)

microcystin-LR (ISO)

morphine (EXP)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorodecanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluoroundecanoic acid (ISO)

phenobarbital (ISO)

phosgene (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (ISO)

rotenone (EXP)

sarin (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

tetrahydropalmatine (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

trichostatin A (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult locomotory behavior (ISO)

amyloid fibril formation (ISO)

negative regulation of peptidase activity (ISO)

negative regulation of proteolysis (ISO)

Cellular Component

cytoplasm (IEA)

cytoplasm (ISO)

cytosol (IBA)

cytosol (ISO)

extracellular space (ISO)

nucleolus (IEA,ISO)

nucleolus (ISO)

nucleus (ISO)

Molecular Function

cysteine-type endopeptidase inhibitor activity (IBA,IEA,ISO)

endopeptidase inhibitor activity (ISO)

protease binding (ISO)

protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Seizures induce widespread upregulation of cystatin B, the gene mutated in progressive myoclonus epilepsy, in rat forebrain neurons.	D'Amato E, etal., Eur J Neurosci 2000 May;12(5):1687-95.
2.	[Physical training aspect of exercise testing: the evaluation of Master's double 2 step test, augmented Master's test and Cooper's submaximum single-level load exercise test (author's transl)].	Fukuda I, etal., Kokyu To Junkan. 1975 Nov;23(11):985-92.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Structural organization of the gene encoding rat cystatin beta.	Sato N, etal., Gene 1992 May 15;114(2):257-60.
12.	Molecular cloning and sequencing of cDNA for rat cystatin beta.	Sato N, etal., Nucleic Acids Res 1990 Nov 25;18(22):6698.
13.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.	Cystatin B and SOD1: protein–protein interaction and possible relation to neurodegeneration.	Ulbrich L, etal., Cell Mol Neurobiol. 2014 Mar;34(2):205-13. doi: 10.1007/s10571-013-0004-y.

Additional References at PubMed

PMID:3053245	PMID:3488317	PMID:6203523	PMID:6626228	PMID:9806543	PMID:11139332	PMID:11514663	PMID:12477932	PMID:12901878	PMID:15277470	PMID:15489334	PMID:19056867
PMID:19199708	PMID:22658674	PMID:23376485	PMID:23533145	PMID:23580065	PMID:24063889	PMID:30052474

Genomics

Comparative Map Data

Cstb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	10,245,462 - 10,247,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,245,462 - 10,247,526 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	10,945,142 - 10,947,182 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,306,047 - 10,308,087 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	10,777,526 - 10,779,568 (-)	NCBI	Rnor_WKY
Rnor_6.0	20	10,966,357 - 10,968,399 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	10,966,331 - 10,968,432 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,137,896 - 13,139,938 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,576,664 - 10,578,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,576,891 - 10,578,923 (-)	NCBI
Celera	20	11,756,111 - 11,758,153 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

CSTB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	43,773,950 - 43,776,308 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	21	43,772,511 - 43,776,330 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	45,193,831 - 45,196,189 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	44,018,259 - 44,020,687 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	44,018,259 - 44,020,687	NCBI
Celera	21	30,299,423 - 30,301,851 (-)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	30,561,944 - 30,564,654 (-)	NCBI		HuRef
CHM1_1	21	44,754,030 - 44,756,740 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	42,129,562 - 42,131,920 (-)	NCBI		T2T-CHM13v2.0

Cstb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	78,261,504 - 78,263,456 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	78,261,503 - 78,263,456 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	78,425,670 - 78,427,622 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	78,425,669 - 78,427,622 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	77,888,415 - 77,890,367 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	77,828,799 - 77,830,751 (+)	NCBI		MGSCv36	mm8
Celera	10	79,447,767 - 79,449,719 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Cstb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	41,475,533 - 41,479,150 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	41,475,533 - 41,478,943 (+)	NCBI	ChiLan1.0	ChiLan1.0

CSTB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	21	43,329,002 - 43,343,874 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	21	30,030,359 - 30,032,899 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

CSTB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	31	36,873,130 - 36,876,156 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	37,261,684 - 37,264,733 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	37,261,716 - 37,264,743 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	37,129,434 - 37,132,462 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	37,115,288 - 37,118,267 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	37,607,453 - 37,610,501 (-)	NCBI		UU_Cfam_GSD_1.0

Cstb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	36,964,516 - 36,965,388 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	502,237 - 503,578 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936500	502,444 - 503,307 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CSTB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	206,706,063 - 206,710,646 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	206,706,060 - 206,710,598 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CSTB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	87,551,341 - 87,555,145 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666054	15,620,453 - 15,625,359 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cstb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	30,153,023 - 30,155,712 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	30,152,988 - 30,155,704 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cstb
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	156
Count of miRNA genes:	110
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000001593
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC084725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF976177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X54737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000001593 ⟹ ENSRNOP00000001593

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,245,462 - 10,247,526 (-)	Ensembl
Rnor_6.0 Ensembl	20	10,966,331 - 10,968,432 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108042 ⟹ ENSRNOP00000077618

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,245,462 - 10,246,891 (-)	Ensembl

RefSeq Acc Id:

NM_012838 ⟹ NP_036970

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	10,245,462 - 10,247,505 (-)	NCBI
Rnor_6.0	20	10,966,357 - 10,968,399 (-)	NCBI
Rnor_5.0	20	13,137,896 - 13,139,938 (-)	NCBI
RGSC_v3.4	20	10,576,664 - 10,578,706 (-)	RGD
Celera	20	11,756,111 - 11,758,153 (-)	RGD

Sequence:

show sequence

GGGGCCGAGCCAGGTTTTTCTAGGGTCCAGACACCCAGGTCTCCTAGTTGGCTCTCTCCGTAGC
TTCTCTGTGATATTCTAACCAGTGCTTGCCAAGATGATGTGTGGCGCGCCATCCGCCACAATGC
CGGCCACGACCGAGACGCAGGAGATCGCCGACAAGGTGAAGTCTCAACTTGAAGAGAAAGCAAA
TCAGAAGTTTGATGTCTTTAAAGCCATATCCTTCAGGAGACAGGTAGTGGCCGGCACCAACTTC
TTCATCAAGGTTGATGTCGGCGAAGAAAAATGTGTGCACTTGAGGGTGTTTGAACCCCTCCCTC
ATGAGAACAAGCCTTTGACCTTGTCTTCTTACCAGACCGACAAAGAAAAGCACGATGAGCTAAC
CTACTTCTGATTCTGCAGCCCCTTTGCCAAATACTTCACCTTTGGAATCCGTGTTTGGGACCAC
GAAGTAAATACCCCTCTGTGAGCAGCTTCCTTTGTGATGCCCAAACGGCGTTGTATTTTGTTTC
TTTCCAAACAATTATTTTCAGAAAACTGTATAAAACTATCTCTCTAAATATATATTTTTAGAGA
CCGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036970	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH84725	(Get FASTA)	NCBI Sequence Viewer
	BAA01462	(Get FASTA)	NCBI Sequence Viewer
	CAA38534	(Get FASTA)	NCBI Sequence Viewer
	EDL97039	(Get FASTA)	NCBI Sequence Viewer
	EDL97040	(Get FASTA)	NCBI Sequence Viewer
	EDL97041	(Get FASTA)	NCBI Sequence Viewer
	EDL97042	(Get FASTA)	NCBI Sequence Viewer
	P01041	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_036970 ⟸ NM_012838
- UniProtKB:	P01041 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MMCGAPSATMPATTETQEIADKVKSQLEEKANQKFDVFKAISFRRQVVAGTNFFIKVDVGEEKC VHLRVFEPLPHENKPLTLSSYQTDKEKHDELTYF hide sequence

RefSeq Acc Id:

ENSRNOP00000001593 ⟸ ENSRNOT00000001593

RefSeq Acc Id:

ENSRNOP00000077618 ⟸ ENSRNOT00000108042

Protein Domains

Cystatin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P01041-F1-model_v2	AlphaFold	P01041	1-98	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701484

Promoter ID:

EPDNEW_R12008

Type:

initiation region

Name:

Cstb_1

Description:

cystatin B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	10,968,388 - 10,968,448	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2435	AgrOrtholog
BioCyc Gene	G2FUF-4285	BioCyc
Ensembl Genes	ENSRNOG00000001201	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000001593	ENTREZGENE
	ENSRNOP00000001593.2	UniProtKB/Swiss-Prot
	ENSRNOP00000077618.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001593	ENTREZGENE
	ENSRNOT00000001593.5	UniProtKB/Swiss-Prot
	ENSRNOT00000108042.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.450.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7318993	IMAGE-MGC_LOAD
InterPro	Cystatin_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cystatin_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_inh_cystat_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_inh_stefin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25308	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105499	IMAGE-MGC_LOAD
NCBI Gene	25308	ENTREZGENE
PANTHER	CYSTATIN-B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11414	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Cystatin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cstb	PhenoGen
PRINTS	STEFINA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CYSTATIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00043	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54403	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228584
UniProt	A0A8I5Y627_RAT	UniProtKB/TrEMBL
	CYTB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-23	Cstb	cystatin B	Cstb	cystatin B (stefin B)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Cstb	cystatin B (stefin B)	Cstb	cystatin B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Cstb	cystatin B		Cystatin beta	Name updated	625702	APPROVED
2002-06-10	Cstb	Cystatin beta			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	mutation of the human homolog causes progressive myoclonus epilepsy EPM1	729930

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM