Symbol:
LOC102013768 (Ensembl: CYP24A1)
Name:
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial (Ensembl:cytochrome P450 family 24 subfamily A member 1)
RGD ID:
8770414
Description:
ENCODES a protein that exhibits 1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity (ortholog); 1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity (ortholog); 25-hydroxycholecalciferol-23-hydroxylase activity (ortholog); INVOLVED IN cellular response to vitamin D (ortholog); osteoblast differentiation (ortholog); response to vitamin D (ortholog); ASSOCIATED WITH autism spectrum disorder (ortholog); breast carcinoma (ortholog); Breast Neoplasms (ortholog); FOUND IN mitochondrion (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CYP24A1 (cytochrome P450 family 24 subfamily A member 1) NCBI
Ortholog
Mus musculus (house mouse):
Cyp24a1 (cytochrome P450, family 24, subfamily a, polypeptide 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Cyp24a1 (cytochrome P450, family 24, subfamily a, polypeptide 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CYP24A1 (cytochrome P450 family 24 subfamily A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CYP24A1 (cytochrome P450 family 24 subfamily A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101957714 (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CYP24A1 (cytochrome P450 family 24 subfamily A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CYP24A1 (cytochrome P450 family 24 subfamily A member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
LOC101716773 (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 4,873,942 - 4,891,780 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 4,874,583 - 4,891,723 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
LOC102013768 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 4,873,942 - 4,891,780 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 4,874,583 - 4,891,723 (+) NCBI ChiLan1.0 ChiLan1.0
CYP24A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 54,143,538 - 54,173,986 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 54,153,446 - 54,173,986 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 52,769,985 - 52,790,525 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 52,203,395 - 52,223,931 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 20 49,474,643 - 49,495,166 (-) NCBI Celera Cytogenetic Map 20 q13.2 NCBI HuRef 20 49,516,544 - 49,537,045 (-) NCBI HuRef CHM1_1 20 52,673,171 - 52,693,667 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 55,917,843 - 55,948,320 (-) NCBI T2T-CHM13v2.0
Cyp24a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 170,324,877 - 170,339,065 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 170,324,628 - 170,339,065 (-) Ensembl GRCm39 Ensembl GRCm38 2 170,482,957 - 170,497,145 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 170,482,708 - 170,497,145 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 170,308,465 - 170,322,638 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 170,174,170 - 170,188,343 (-) NCBI MGSCv36 mm8 Celera 2 176,437,445 - 176,451,588 (-) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 91.91 NCBI
Cyp24a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 179,694,647 - 179,709,083 (-) NCBI GRCr8 mRatBN7.2 3 159,275,947 - 159,290,383 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 159,275,947 - 159,290,383 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 163,075,289 - 163,089,740 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 171,574,931 - 171,589,382 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 169,316,153 - 169,330,604 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 168,097,484 - 168,111,920 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 168,097,485 - 168,111,920 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 174,200,349 - 174,214,780 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 161,542,131 - 161,553,801 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 161,445,746 - 161,460,193 (-) NCBI Celera 3 157,820,209 - 157,834,648 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
CYP24A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 59,906,065 - 59,926,662 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 59,899,186 - 59,919,783 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 50,500,103 - 50,520,487 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 51,721,895 - 51,742,716 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 51,721,685 - 51,742,716 (-) Ensembl panpan1.1 panPan2
CYP24A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 39,861,018 - 39,878,161 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 39,862,355 - 39,878,216 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 39,106,835 - 39,123,588 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 40,574,274 - 40,591,063 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 40,576,845 - 40,591,462 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 39,809,842 - 39,826,569 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 39,945,173 - 39,961,923 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 40,527,730 - 40,544,495 (-) NCBI UU_Cfam_GSD_1.0
LOC101957714 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 186,013,122 - 186,029,747 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 1,467,261 - 1,480,185 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 1,467,460 - 1,480,185 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYP24A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 55,110,590 - 55,130,363 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 55,110,546 - 55,130,328 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 61,891,352 - 61,912,269 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYP24A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 9,868,794 - 9,889,510 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 9,868,678 - 9,885,884 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 57,988,669 - 58,009,485 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101716773
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000010146 ⟹ ENSCLAP00000010016
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955445 4,873,942 - 4,891,780 (+) Ensembl
Ensembl Acc Id:
ENSCLAT00000010147 ⟹ ENSCLAP00000010017
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955445 4,873,942 - 4,891,780 (+) Ensembl
RefSeq Acc Id:
XM_005392282 ⟹ XP_005392339
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955445 4,874,583 - 4,891,723 (+) NCBI
Sequence:
CTGCTATGAGCTGCCCTGTGCGCAAGAGCCGCTCTCTGGCCGCCTTCCCGCGGCGGCTGTGTAGCCTCCAGCAGCCCCTGAGACCTGTGACATCCAGGACGCGGGCGCCACCTCCGCTGCAGGAGGTG
hide sequence
RefSeq Acc Id:
XP_005392339 ⟸ XM_005392282
- UniProtKB:
A0A8C2V978 (UniProtKB/TrEMBL)
- Sequence:
MSCPVRKSRSLAAFPRRLCSLQQPLRPVTSRTRAPPPLQEVPPFPPMAPGETQSAAVLPGPTNWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFDSVHLGSPSLLEGLYRTESACPQR
hide sequence
Ensembl Acc Id:
ENSCLAP00000010016 ⟸ ENSCLAT00000010146
Ensembl Acc Id:
ENSCLAP00000010017 ⟸ ENSCLAT00000010147
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-25
LOC102013768
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial-like
Symbol and/or name change
5135510 APPROVED
