Symbol:
SOD3
Name:
superoxide dismutase 3
RGD ID:
736515
HGNC Page
HGNC:11181
Description:
Enables molecular adaptor activity. Predicted to be involved in removal of superoxide radicals. Predicted to act upstream of or within response to hypoxia. Located in collagen-containing extracellular matrix. Implicated in several diseases, including coronary artery disease (multiple); diabetes mellitus (multiple); diabetic retinopathy; lung disease (multiple); and polyneuropathy. Biomarker of intermediate coronary syndrome and myocardial infarction.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
EC-SOD; extracellular superoxide dismutase; extracellular superoxide dismutase [Cu-Zn]; MGC20077; superoxide dismutase 3, extracellular; testicular tissue protein Li 175
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Sod3 (superoxide dismutase 3, extracellular) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Sod3 (superoxide dismutase 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Sod3 (superoxide dismutase 3) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
SOD3 (superoxide dismutase 3) NCBI
Ortholog
Canis lupus familiaris (dog):
SOD3 (superoxide dismutase 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Sus scrofa (pig):
SOD3 (superoxide dismutase 3) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
SOD3 (superoxide dismutase 3) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Sod3 (superoxide dismutase 3) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Psma2 (proteasome 20S subunit alpha 2) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Sod3 (superoxide dismutase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sod3 (superoxide dismutase 3, extracellular)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sod3b (superoxide dismutase 3, extracellular b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
sod3a (superoxide dismutase 3, extracellular a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
CG5948
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
SOD1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sod-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sod-5
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
sod3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
sod3.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
sod3.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 24,795,573 - 24,800,842 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 24,789,912 - 24,800,842 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 24,797,195 - 24,802,464 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 24,406,183 - 24,411,565 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 24,472,323 - 24,478,733 NCBI Celera 4 25,246,551 - 25,251,936 (+) NCBI Celera Cytogenetic Map 4 p15.2 NCBI HuRef 4 24,139,594 - 24,144,972 (+) NCBI HuRef CHM1_1 4 24,796,442 - 24,801,824 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 24,777,502 - 24,782,774 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
SOD3 Human (+)-catechin multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Catechin] results in decreased expression of SOD3 mRNA CTD PMID:35883890 SOD3 Human (-)-epigallocatechin 3-gallate decreases expression EXP 6480464 epigallocatechin gallate results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human (E)-cinnamyl alcohol increases expression EXP 6480464 cinnamyl alcohol results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human 1,1-dichloroethene decreases expression ISO Sod3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SOD3 mRNA CTD PMID:26682919 SOD3 Human 1,2-dimethylhydrazine decreases expression ISO Sod3 (Rattus norvegicus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SOD3 mRNA CTD PMID:32387197 SOD3 Human 1-chloro-2,4-dinitrobenzene increases expression EXP 6480464 Dinitrochlorobenzene results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human 17alpha-ethynylestradiol affects expression ISO Sod3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SOD3 mRNA CTD PMID:17555576 SOD3 Human 17alpha-ethynylestradiol decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of SOD3 mRNA CTD PMID:17557909 and PMID:29097150 SOD3 Human 17alpha-ethynylestradiol multiple interactions ISO Sod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOD3 mRNA CTD PMID:17942748 SOD3 Human 17beta-estradiol decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of SOD3 mRNA and Estradiol results in decreased expression of SOD3 protein CTD PMID:23027624 and PMID:24894866 SOD3 Human 17beta-estradiol decreases expression ISO Sod3 (Mus musculus) 6480464 Estradiol results in decreased expression of SOD3 mRNA CTD PMID:39298647 SOD3 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SOD3 mRNA and Estradiol results in decreased expression of SOD3 protein CTD PMID:25130429 and PMID:28960787 SOD3 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of SOD3 mRNA more ... CTD PMID:25130429 and PMID:30165855 SOD3 Human 17beta-estradiol decreases activity ISO Sod3 (Rattus norvegicus) 6480464 Estradiol results in decreased activity of SOD3 protein CTD PMID:23027624 SOD3 Human 17beta-estradiol increases expression ISO Sod3 (Rattus norvegicus) 6480464 Estradiol results in increased expression of SOD3 mRNA CTD PMID:12816884 more ... SOD3 Human 17beta-estradiol increases stability ISO Sod3 (Rattus norvegicus) 6480464 Estradiol results in increased stability of SOD3 mRNA CTD PMID:12816884 SOD3 Human 17beta-estradiol multiple interactions ISO Sod3 (Mus musculus) 6480464 Estradiol inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 SOD3 Human 17beta-estradiol affects expression ISO Sod3 (Mus musculus) 6480464 Estradiol affects the expression of SOD3 mRNA CTD PMID:16195479 SOD3 Human 17beta-estradiol multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Ascorbic Acid inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:12816884 more ... SOD3 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Sod3 (Rattus norvegicus) 6480464 2 more ... CTD PMID:21394737 SOD3 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31675489 SOD3 Human 2,2,2-tetramine multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of SOD3 mRNA] and Trientine inhibits the reaction [Streptozocin results in decreased expression of SOD3 protein] CTD PMID:16973718 SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOD3 mRNA and actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA] CTD PMID:17942748 and PMID:28836330 SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sod3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:32109520 more ... SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA CTD PMID:28836330 and PMID:33956508 SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:15034205 and PMID:15667827 SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SOD3 mRNA CTD PMID:21570461 SOD3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SOD3 mRNA CTD PMID:21296121 SOD3 Human 2,5-hexanedione increases expression ISO Sod3 (Rattus norvegicus) 6480464 2 and 5-hexanedione results in increased expression of SOD3 mRNA CTD PMID:22952946 and PMID:27466211 SOD3 Human 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Puromycin Aminonucleoside results in decreased expression of SOD3 mRNA CTD PMID:20685819 SOD3 Human 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Sod3 (Mus musculus) 6480464 3 more ... CTD PMID:37080397 SOD3 Human 3-chloropropane-1,2-diol increases expression ISO Sod3 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of SOD3 mRNA CTD PMID:28522335 SOD3 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Sod3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of SOD3 mRNA CTD PMID:16054899 SOD3 Human 4,4'-sulfonyldiphenol increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol S results in increased expression of SOD3 mRNA CTD PMID:30951980 and PMID:39298647 SOD3 Human 4,4'-sulfonyldiphenol decreases methylation ISO Sod3 (Mus musculus) 6480464 bisphenol S results in decreased methylation of SOD3 exon CTD PMID:33297965 SOD3 Human 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Oxazolone results in decreased expression of SOD3 mRNA CTD PMID:21893156 SOD3 Human 4-hydroxyphenyl retinamide decreases expression ISO Sod3 (Mus musculus) 6480464 Fenretinide results in decreased expression of SOD3 mRNA CTD PMID:28973697 SOD3 Human 4-phenylbutyric acid multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 4-phenylbutyric acid inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] CTD PMID:21804221 SOD3 Human 4-phenylbutyric acid increases expression ISO Sod3 (Rattus norvegicus) 6480464 4-phenylbutyric acid results in increased expression of SOD3 mRNA CTD PMID:21804221 SOD3 Human 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid increases expression EXP 6480464 acipimox results in increased expression of SOD3 mRNA CTD PMID:25352640 SOD3 Human 6-propyl-2-thiouracil decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SOD3 mRNA CTD PMID:24780913 and PMID:36843608 SOD3 Human 6-propyl-2-thiouracil increases expression ISO Sod3 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SOD3 mRNA CTD PMID:30047161 SOD3 Human acetamide increases expression ISO Sod3 (Rattus norvegicus) 6480464 acetamide results in increased expression of SOD3 mRNA CTD PMID:31881176 SOD3 Human acrolein increases expression ISO Sod3 (Mus musculus) 6480464 Acrolein results in increased expression of SOD3 protein CTD PMID:28482051 SOD3 Human Actein multiple interactions ISO Sod3 (Mus musculus) 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SOD3 mRNA] CTD PMID:28836330 SOD3 Human aldehydo-D-glucose decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 SOD3 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of SOD3 mRNA CTD PMID:15498508 SOD3 Human alpha-hexylcinnamaldehyde increases expression EXP 6480464 hexyl cinnamic aldehyde results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human amitrole increases expression ISO Sod3 (Rattus norvegicus) 6480464 Amitrole results in increased expression of SOD3 mRNA CTD PMID:30047161 SOD3 Human ammonium chloride affects expression ISO Sod3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SOD3 mRNA CTD PMID:16483693 SOD3 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of SOD3 mRNA CTD PMID:33212167 SOD3 Human arsenite(3-) increases methylation EXP 6480464 arsenite results in increased methylation of SOD3 promoter CTD PMID:23974009 SOD3 Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of SOD3 mRNA CTD PMID:29633893 SOD3 Human asbestos increases secretion ISO Sod3 (Mus musculus) 6480464 Asbestos results in increased secretion of SOD3 protein CTD PMID:21362472 SOD3 Human asbestos multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 gene polymorphism promotes the reaction [Asbestos results in increased secretion of SOD3 protein] CTD PMID:21362472 SOD3 Human asbestos affects response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 gene polymorphism affects the susceptibility to Asbestos and SOD3 protein affects the susceptibility to Asbestos CTD PMID:16458190 and PMID:21362472 SOD3 Human atorvastatin calcium increases expression ISO Sod3 (Rattus norvegicus) 6480464 Atorvastatin results in increased expression of SOD3 protein CTD PMID:19451411 SOD3 Human atrazine multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of SOD3 mRNA] CTD PMID:36216167 SOD3 Human atrazine increases expression ISO Sod3 (Mus musculus) 6480464 Atrazine results in increased expression of SOD3 mRNA CTD PMID:36216167 SOD3 Human azoxystrobin multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 SOD3 Human Bandrowski's base increases expression EXP 6480464 Bandrowski's base results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human benzo[a]pyrene decreases expression ISO Sod3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SOD3 mRNA CTD PMID:15034205 SOD3 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of SOD3 5' UTR CTD PMID:27901495 SOD3 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of SOD3 promoter CTD PMID:27901495 SOD3 Human benzo[a]pyrene multiple interactions ISO Sod3 (Mus musculus) 6480464 [lipopolysaccharide more ... CTD PMID:14625279 and PMID:28987381 SOD3 Human benzo[a]pyrene increases expression ISO Sod3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SOD3 mRNA CTD PMID:14625279 SOD3 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:35917956 and PMID:36610486 SOD3 Human bis(2-ethylhexyl) phthalate decreases expression ISO Sod3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SOD3 mRNA CTD PMID:34319233 SOD3 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Genistein inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:26316063 SOD3 Human bis(2-ethylhexyl) phthalate increases expression ISO Sod3 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in increased expression of SOD3 mRNA CTD PMID:26316063 SOD3 Human bis(2-ethylhexyl) phthalate increases expression ISO Sod3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SOD3 mRNA CTD PMID:33360214 more ... SOD3 Human bisphenol A affects expression ISO Sod3 (Rattus norvegicus) 6480464 bisphenol A affects the expression of SOD3 mRNA CTD PMID:25181051 SOD3 Human bisphenol A decreases expression ISO Sod3 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SOD3 mRNA CTD PMID:38750585 SOD3 Human bisphenol A affects expression ISO Sod3 (Mus musculus) 6480464 bisphenol A affects the expression of SOD3 mRNA CTD PMID:35341816 SOD3 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SOD3 protein CTD PMID:31675489 SOD3 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SOD3 gene CTD PMID:31601247 SOD3 Human bisphenol A decreases expression ISO Sod3 (Mus musculus) 6480464 bisphenol A results in decreased expression of SOD3 mRNA CTD PMID:30245210 more ... SOD3 Human bisphenol A increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol A results in increased expression of SOD3 mRNA CTD PMID:30951980 and PMID:37755785 SOD3 Human bisphenol A increases methylation ISO Sod3 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of SOD3 gene CTD PMID:28505145 SOD3 Human bisphenol F increases expression ISO Sod3 (Mus musculus) 6480464 bisphenol F results in increased expression of SOD3 mRNA CTD PMID:30951980 SOD3 Human buspirone decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Buspirone results in decreased expression of SOD3 mRNA CTD PMID:24136188 SOD3 Human butylated hydroxyanisole multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Butylated Hydroxyanisole inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:23027624 SOD3 Human butylated hydroxyanisole increases activity ISO Sod3 (Rattus norvegicus) 6480464 Butylated Hydroxyanisole results in increased activity of SOD3 protein CTD PMID:23027624 SOD3 Human butylated hydroxyanisole increases expression ISO Sod3 (Rattus norvegicus) 6480464 Butylated Hydroxyanisole results in increased expression of SOD3 mRNA and Butylated Hydroxyanisole results in increased expression of SOD3 protein CTD PMID:23027624 SOD3 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SOD3 mRNA CTD PMID:35301059 SOD3 Human cadmium dichloride increases expression ISO Sod3 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of SOD3 mRNA CTD PMID:30375035 SOD3 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SOD3 mRNA CTD PMID:35301059 SOD3 Human calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of SOD3 mRNA CTD PMID:26485663 SOD3 Human carbendazim increases expression ISO Sod3 (Rattus norvegicus) 6480464 carbendazim results in increased expression of SOD3 mRNA CTD PMID:27466211 SOD3 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to SOD3 gene] CTD PMID:28238834 SOD3 Human chloroethene decreases expression ISO Sod3 (Mus musculus) 6480464 Vinyl Chloride results in decreased expression of SOD3 protein CTD PMID:34717031 SOD3 Human chlorogenic acid decreases expression EXP 6480464 Chlorogenic Acid results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human chlorpyrifos decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of SOD3 mRNA CTD PMID:17452286 SOD3 Human chlorpyrifos multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 SOD3 Human cholic acid increases expression ISO Sod3 (Mus musculus) 6480464 Cholic Acid results in increased expression of SOD3 mRNA CTD PMID:25496033 SOD3 Human cholic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1H4 gene mutant form inhibits the reaction [Cholic Acid results in increased expression of SOD3 mRNA] CTD PMID:25496033 SOD3 Human ciglitazone decreases expression ISO Sod3 (Rattus norvegicus) 6480464 ciglitazone results in decreased expression of SOD3 mRNA CTD PMID:22193206 SOD3 Human cinnamyl alcohol increases expression EXP 6480464 cinnamyl alcohol results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human cisplatin affects response to substance EXP 6480464 SOD3 protein affects the susceptibility to Cisplatin CTD PMID:16217747 SOD3 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SOD3 mRNA CTD PMID:25450742 SOD3 Human cisplatin decreases expression ISO Sod3 (Mus musculus) 6480464 Cisplatin results in decreased expression of SOD3 mRNA CTD PMID:24865317 SOD3 Human cisplatin multiple interactions ISO Sod3 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of SOD3 mRNA CTD PMID:24865317 SOD3 Human cisplatin decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Cisplatin results in decreased expression of SOD3 mRNA CTD PMID:23603837 SOD3 Human cisplatin increases expression ISO Sod3 (Mus musculus) 6480464 Cisplatin results in increased expression of SOD3 mRNA CTD PMID:21151649 SOD3 Human clofibrate decreases expression ISO Sod3 (Mus musculus) 6480464 Clofibrate results in decreased expression of SOD3 mRNA CTD PMID:17585979 SOD3 Human clofibrate increases expression ISO Sod3 (Rattus norvegicus) 6480464 Clofibrate results in increased expression of SOD3 mRNA CTD PMID:11328961 SOD3 Human clozapine increases expression ISO Sod3 (Rattus norvegicus) 6480464 Clozapine results in increased expression of SOD3 mRNA CTD PMID:15860345 SOD3 Human cobalt dichloride multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 4-phenylbutyric acid inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] and Acetylcysteine inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] CTD PMID:21804221 SOD3 Human cobalt dichloride decreases expression ISO Sod3 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of SOD3 mRNA CTD PMID:21804221 and PMID:24386269 SOD3 Human cobalt dichloride decreases expression ISO Sod3 (Mus musculus) 6480464 cobaltous chloride results in decreased expression of SOD3 mRNA CTD PMID:20594416 SOD3 Human copper atom multiple interactions ISO Sod3 (Mus musculus) 6480464 [Copper co-treated with ATOX1 protein] results in increased activity of SOD3 protein more ... CTD PMID:18165226 more ... SOD3 Human copper atom increases expression ISO Sod3 (Mus musculus) 6480464 Copper results in increased expression of SOD3 mRNA CTD PMID:16629173 and PMID:18977292 SOD3 Human copper(0) multiple interactions ISO Sod3 (Mus musculus) 6480464 [Copper co-treated with ATOX1 protein] results in increased activity of SOD3 protein more ... CTD PMID:18165226 more ... SOD3 Human copper(0) increases expression ISO Sod3 (Mus musculus) 6480464 Copper results in increased expression of SOD3 mRNA CTD PMID:16629173 and PMID:18977292 SOD3 Human crocidolite asbestos multiple interactions ISO Sod3 (Mus musculus) 6480464 Asbestos and Crocidolite affects the expression of and affects the activity of SOD3 protein CTD PMID:15298984 SOD3 Human crocidolite asbestos affects response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 protein affects the susceptibility to Asbestos and Crocidolite CTD PMID:18165226 SOD3 Human cumene multiple interactions ISO Sod3 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of SOD3 mRNA CTD PMID:18648096 SOD3 Human D-glucose decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 SOD3 Human DDT increases expression ISO Sod3 (Rattus norvegicus) 6480464 DDT results in increased expression of SOD3 mRNA CTD PMID:30207508 SOD3 Human decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of SOD3 protein CTD PMID:31675489 SOD3 Human dexamethasone multiple interactions ISO Sod3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of SOD3 mRNA CTD PMID:16054899 SOD3 Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of SOD3 mRNA CTD PMID:29633893 SOD3 Human diazinon decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Diazinon results in decreased expression of SOD3 mRNA CTD PMID:17452286 SOD3 Human dibutyl phthalate decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of SOD3 mRNA CTD PMID:21266533 SOD3 Human dimethyl sulfoxide increases expression ISO Sod3 (Rattus norvegicus) 6480464 Dimethyl Sulfoxide results in increased expression of SOD3 mRNA CTD PMID:22193206 SOD3 Human dioxygen decreases expression ISO Sod3 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of SOD3 mRNA CTD PMID:20594416 SOD3 Human dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Catechin] results in decreased expression of SOD3 mRNA CTD PMID:35883890 SOD3 Human disulfiram increases expression EXP 6480464 Disulfiram results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human diuron decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Diuron results in decreased expression of SOD3 mRNA CTD PMID:25152437 SOD3 Human diuron increases expression ISO Sod3 (Rattus norvegicus) 6480464 Diuron results in increased expression of SOD3 mRNA CTD PMID:21551480 SOD3 Human donepezil hydrochloride multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Donepezil inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 SOD3 Human doxorubicin decreases expression ISO Sod3 (Mus musculus) 6480464 Doxorubicin results in decreased expression of SOD3 mRNA and Doxorubicin results in decreased expression of SOD3 protein CTD PMID:26822305 SOD3 Human doxorubicin decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Doxorubicin results in decreased expression of SOD3 protein CTD PMID:34358621 SOD3 Human doxorubicin multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Acetylcysteine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] and Phosphocreatine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:34358621 SOD3 Human doxorubicin affects expression EXP 6480464 Doxorubicin affects the expression of SOD3 mRNA CTD PMID:29803840 SOD3 Human doxorubicin multiple interactions ISO Sod3 (Mus musculus) 6480464 Doxorubicin promotes the reaction [ABCC1 gene mutant form results in decreased expression of SOD3 mRNA] and Doxorubicin promotes the reaction [ABCC1 gene mutant form results in decreased expression of SOD3 protein] CTD PMID:26822305 SOD3 Human ellagic acid decreases expression EXP 6480464 Ellagic Acid results in decreased expression of SOD3 mRNA CTD PMID:12002526 SOD3 Human epoxiconazole decreases expression ISO Sod3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SOD3 mRNA CTD PMID:35436446 SOD3 Human ethanol increases expression ISO Sod3 (Mus musculus) 6480464 Ethanol results in increased expression of SOD3 mRNA CTD PMID:30319688 SOD3 Human eugenol increases expression EXP 6480464 Eugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human fenthion increases expression ISO Sod3 (Mus musculus) 6480464 Fenthion results in increased expression of SOD3 mRNA CTD PMID:34813904 SOD3 Human finasteride affects expression ISO Sod3 (Rattus norvegicus) 6480464 Finasteride affects the expression of SOD3 mRNA and Finasteride affects the expression of SOD3 protein CTD PMID:18811921 SOD3 Human flutamide decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of SOD3 mRNA CTD PMID:24136188 SOD3 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of SOD3 mRNA CTD PMID:28937961 SOD3 Human fulvestrant multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of SOD3 mRNA] CTD PMID:12816884 SOD3 Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human genistein multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Genistein inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:26316063 SOD3 Human glucose decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Glucose results in decreased expression of SOD3 mRNA CTD PMID:21818840 SOD3 Human glycyrrhetinate multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 SOD3 Human glycyrrhetinic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 SOD3 Human glyphosate multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 SOD3 Human GW 4064 multiple interactions EXP 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to SOD3 promoter] more ... CTD PMID:25496033 SOD3 Human GW 4064 multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1H4 gene mutant form inhibits the reaction [GW 4064 results in increased expression of SOD3 mRNA] CTD PMID:25496033 SOD3 Human GW 4064 increases expression ISO Sod3 (Mus musculus) 6480464 GW 4064 results in increased expression of SOD3 mRNA CTD PMID:25496033 SOD3 Human GW 4064 increases expression EXP 6480464 GW 4064 results in increased expression of SOD3 mRNA CTD PMID:25496033 SOD3 Human GW 501516 multiple interactions EXP 6480464 GW 501516 inhibits the reaction [APP gene mutant form results in decreased expression of SOD3 protein] CTD PMID:22886847 SOD3 Human haloperidol increases expression ISO Sod3 (Rattus norvegicus) 6480464 Haloperidol results in increased expression of SOD3 mRNA CTD PMID:15860345 SOD3 Human hexachlorobenzene affects expression ISO Sod3 (Rattus norvegicus) 6480464 Hexachlorobenzene affects the expression of SOD3 mRNA CTD PMID:15159207 SOD3 Human hyaluronic acid affects binding ISO Sod3 (Mus musculus) 6480464 SOD3 protein binds to Hyaluronic Acid CTD PMID:18165226 SOD3 Human hyaluronic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 protein inhibits the reaction [[Copper co-treated with Hydrogen Peroxide] results in increased degradation of Hyaluronic Acid] CTD PMID:18165226 SOD3 Human hydrogen cyanide decreases expression ISO Sod3 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of SOD3 mRNA CTD PMID:33914522 SOD3 Human hydrogen peroxide multiple interactions ISO Sod3 (Mus musculus) 6480464 SOD3 protein inhibits the reaction [[Copper co-treated with Hydrogen Peroxide] results in increased degradation of Hyaluronic Acid] CTD PMID:18165226 SOD3 Human hydrogen peroxide multiple interactions EXP 6480464 SOD3 promotes the reaction [GW 4064 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK8 protein]] and SOD3 promotes the reaction [GW 4064 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPK9 protein]] CTD PMID:25496033 SOD3 Human imidacloprid multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 SOD3 Human inulin multiple interactions ISO Sod3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SOD3 mRNA CTD PMID:36331819 SOD3 Human isoeugenol increases expression EXP 6480464 isoeugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human ketamine increases expression ISO Sod3 (Rattus norvegicus) 6480464 Ketamine results in increased expression of SOD3 mRNA CTD PMID:20080153 SOD3 Human L-ascorbic acid affects localization ISO Sod3 (Rattus norvegicus) 6480464 Ascorbic Acid affects the localization of SOD3 protein CTD PMID:23027624 SOD3 Human L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and Ascorbic Acid inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:25130429 SOD3 Human L-ascorbic acid increases activity ISO Sod3 (Rattus norvegicus) 6480464 Ascorbic Acid results in increased activity of SOD3 protein CTD PMID:23027624 SOD3 Human L-ascorbic acid multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Ascorbic Acid inhibits the reaction [Estradiol inhibits the reaction [NFE2L2 protein binds to SOD3 promoter]] more ... CTD PMID:23027624 SOD3 Human L-ascorbic acid increases expression ISO Sod3 (Rattus norvegicus) 6480464 Ascorbic Acid results in increased expression of SOD3 protein CTD PMID:23027624 SOD3 Human lead diacetate affects expression ISO Sod3 (Rattus norvegicus) 6480464 lead acetate affects the expression of SOD3 mRNA CTD PMID:21864555 SOD3 Human lead diacetate increases expression ISO Sod3 (Mus musculus) 6480464 lead acetate results in increased expression of SOD3 mRNA CTD PMID:29746905 SOD3 Human lead(0) increases expression ISO Sod3 (Rattus norvegicus) 6480464 Lead results in increased expression of SOD3 protein CTD PMID:25596430 SOD3 Human losartan multiple interactions ISO Sod3 (Mus musculus) 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of SOD3 protein] CTD PMID:10400907 SOD3 Human lutein multiple interactions ISO Sod3 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of SOD3 mRNA CTD PMID:24865317 SOD3 Human lutein decreases expression ISO Sod3 (Mus musculus) 6480464 Lutein results in decreased expression of SOD3 mRNA CTD PMID:24865317 SOD3 Human lycopene multiple interactions ISO Sod3 (Mus musculus) 6480464 Lycopene inhibits the reaction [Atrazine results in increased expression of SOD3 mRNA] and Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of SOD3 mRNA] CTD PMID:35917956 more ... SOD3 Human mercury dichloride increases expression ISO Sod3 (Rattus norvegicus) 6480464 Mercuric Chloride results in increased expression of SOD3 protein CTD PMID:18599595 and PMID:23415682 SOD3 Human methotrexate increases expression EXP 6480464 Methotrexate results in increased expression of SOD3 mRNA CTD PMID:21678067 SOD3 Human methyl tert-butyl ether increases activity ISO Sod3 (Rattus norvegicus) 6480464 methyl tert-butyl ether results in increased activity of SOD3 protein CTD PMID:19150650 SOD3 Human methylmercury chloride decreases expression ISO Sod3 (Rattus norvegicus) 6480464 methylmercuric chloride results in decreased expression of SOD3 protein CTD PMID:29258870 SOD3 Human mifepristone multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Mifepristone inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 SOD3 Human N,N-diethyl-m-toluamide multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 SOD3 Human N-acetyl-L-cysteine multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Acetylcysteine inhibits the reaction [cobaltous chloride results in decreased expression of SOD3 mRNA] and Acetylcysteine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:21804221 and PMID:34358621 SOD3 Human N-phosphocreatine multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in decreased expression of SOD3 protein] CTD PMID:34358621 SOD3 Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human nimesulide decreases expression ISO Sod3 (Rattus norvegicus) 6480464 nimesulide results in decreased expression of SOD3 mRNA CTD PMID:24136188 SOD3 Human nitrogen dioxide multiple interactions EXP 6480464 [[Vehicle Emissions results in increased abundance of Soot] co-treated with [Air Pollutants results in increased abundance of [Sulfur Dioxide co-treated with Nitrogen Dioxide]]] results in increased expression of SOD3 mRNA CTD PMID:35736886 SOD3 Human ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of SOD3 mRNA CTD PMID:17316727 SOD3 Human Osajin decreases expression EXP 6480464 osajin results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human ozone multiple interactions ISO Sod3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SOD3 mRNA and SOD3 protein inhibits the reaction [Ozone results in increased expression of IL6 protein] CTD PMID:11999998 and PMID:34911549 SOD3 Human paracetamol multiple interactions ISO Sod3 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in decreased expression of SOD3 mRNA] and SOD3 inhibits the reaction [Acetaminophen results in increased activity of CASP3 protein] CTD PMID:11529661 and PMID:30099449 SOD3 Human paracetamol decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of SOD3 mRNA CTD PMID:33387578 SOD3 Human paracetamol decreases expression ISO Sod3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of SOD3 mRNA CTD PMID:30099449 SOD3 Human paraquat decreases expression ISO Sod3 (Mus musculus) 6480464 Paraquat results in decreased expression of SOD3 mRNA CTD PMID:17215068 and PMID:26108578 SOD3 Human paraquat multiple interactions EXP 6480464 [Quercetin co-treated with Paraquat] results in increased expression of SOD3 mRNA CTD PMID:22996356 SOD3 Human paraquat increases expression EXP 6480464 Paraquat results in increased expression of SOD3 mRNA CTD PMID:22996356 SOD3 Human paraquat multiple interactions ISO Sod3 (Mus musculus) 6480464 APOD protein affects the reaction [Paraquat results in increased expression of SOD3 mRNA] CTD PMID:21688324 SOD3 Human paraquat increases expression ISO Sod3 (Mus musculus) 6480464 Paraquat results in increased expression of SOD3 mRNA CTD PMID:12732627 and PMID:21688324 SOD3 Human paricalcitol multiple interactions EXP 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 SOD3 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Sod3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SOD3 mRNA CTD PMID:36331819 SOD3 Human permethrin multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 SOD3 Human peroxynitrous acid multiple interactions ISO Sod3 (Mus musculus) 6480464 [Streptozocin results in decreased activity of SOD3 protein] which results in increased chemical synthesis of Peroxynitrous Acid CTD PMID:23884884 SOD3 Human phenobarbital multiple interactions ISO Sod3 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of SOD3 mRNA] CTD PMID:19482888 SOD3 Human phenobarbital affects expression ISO Sod3 (Mus musculus) 6480464 Phenobarbital affects the expression of SOD3 mRNA CTD PMID:23091169 SOD3 Human phenobarbital decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Phenobarbital results in decreased expression of SOD3 mRNA CTD PMID:19162173 SOD3 Human phenobarbital decreases expression ISO Sod3 (Mus musculus) 6480464 Phenobarbital results in decreased expression of SOD3 mRNA CTD PMID:19482888 SOD3 Human phosgene affects expression ISO Sod3 (Mus musculus) 6480464 Phosgene affects the expression of SOD3 mRNA CTD PMID:16300373 SOD3 Human phosphorus atom multiple interactions EXP 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 SOD3 Human phosphorus(.) multiple interactions EXP 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of SOD3 mRNA CTD PMID:17715259 SOD3 Human Pomiferin decreases expression EXP 6480464 pomiferin results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human potassium chromate multiple interactions ISO Sod3 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of SOD3 mRNA] CTD PMID:14625279 SOD3 Human potassium cyanide increases expression ISO Sod3 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of SOD3 mRNA CTD PMID:33914522 SOD3 Human potassium dichromate multiple interactions ISO Sod3 (Mus musculus) 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of SOD3 mRNA] CTD PMID:14625279 SOD3 Human pregnenolone 16alpha-carbonitrile decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in decreased expression of SOD3 mRNA CTD PMID:19162173 SOD3 Human probucol multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Probucol inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 SOD3 Human progesterone decreases expression ISO Sod3 (Mus musculus) 6480464 Progesterone results in decreased expression of SOD3 mRNA CTD PMID:16195479 SOD3 Human progesterone decreases activity ISO Sod3 (Rattus norvegicus) 6480464 Progesterone results in decreased activity of SOD3 protein CTD PMID:16195479 SOD3 Human progesterone decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Progesterone results in decreased expression of SOD3 mRNA CTD PMID:16195479 SOD3 Human progesterone multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Mifepristone inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] and Progesterone inhibits the reaction [Estradiol results in increased expression of SOD3 mRNA] CTD PMID:16195479 SOD3 Human progesterone multiple interactions ISO Sod3 (Mus musculus) 6480464 Estradiol inhibits the reaction [Progesterone results in decreased expression of SOD3 mRNA] CTD PMID:16195479 SOD3 Human puerarin decreases expression EXP 6480464 puerarin results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human Pyridostigmine bromide multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of SOD3 mRNA CTD PMID:28659758 SOD3 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of SOD3 mRNA CTD PMID:22996356 SOD3 Human quercetin multiple interactions EXP 6480464 [Quercetin co-treated with Paraquat] results in increased expression of SOD3 mRNA CTD PMID:22996356 SOD3 Human raloxifene increases expression ISO Sod3 (Rattus norvegicus) 6480464 Raloxifene Hydrochloride results in increased expression of SOD3 mRNA CTD PMID:15576828 SOD3 Human resveratrol increases expression ISO Sod3 (Rattus norvegicus) 6480464 resveratrol results in increased expression of SOD3 mRNA and resveratrol results in increased expression of SOD3 protein CTD PMID:24894866 SOD3 Human resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:25130429 SOD3 Human resveratrol increases expression ISO Sod3 (Mus musculus) 6480464 resveratrol results in increased expression of SOD3 mRNA CTD PMID:20610621 SOD3 Human resveratrol increases expression EXP 6480464 resveratrol results in increased expression of SOD3 more ... CTD PMID:20610621 and PMID:28960787 SOD3 Human resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human resveratrol multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 mRNA] and resveratrol inhibits the reaction [Estradiol results in decreased expression of SOD3 protein] CTD PMID:24894866 SOD3 Human Rosavin decreases expression EXP 6480464 rosavin results in decreased expression of SOD3 mRNA CTD PMID:20706672 SOD3 Human rotenone multiple interactions ISO Sod3 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in decreased expression of SOD3 mRNA] CTD PMID:30099449 SOD3 Human serpentine asbestos decreases expression ISO Sod3 (Mus musculus) 6480464 Asbestos and Serpentine results in decreased expression of SOD3 mRNA CTD PMID:16251409 SOD3 Human silicon dioxide increases response to substance ISO Sod3 (Mus musculus) 6480464 SOD3 gene mutant form results in increased susceptibility to Silicon Dioxide CTD PMID:30453980 SOD3 Human silicon dioxide increases expression ISO Sod3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of SOD3 mRNA CTD PMID:38403151 SOD3 Human silicon dioxide multiple interactions ISO Sod3 (Mus musculus) 6480464 [SOD3 gene mutant form results in increased susceptibility to Silicon Dioxide] which results in increased expression of CCL2 mRNA more ... CTD PMID:30453980 SOD3 Human silicon dioxide decreases expression ISO Sod3 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of SOD3 mRNA and Silicon Dioxide results in decreased expression of SOD3 protein CTD PMID:30453980 SOD3 Human silver atom decreases expression ISO Sod3 (Mus musculus) 6480464 Silver results in decreased expression of SOD3 mRNA CTD PMID:19429238 SOD3 Human silver(0) decreases expression ISO Sod3 (Mus musculus) 6480464 Silver results in decreased expression of SOD3 mRNA CTD PMID:19429238 SOD3 Human simvastatin multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 Simvastatin inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 SOD3 Human sodium arsenite decreases expression ISO Sod3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SOD3 mRNA CTD PMID:21396911 SOD3 Human sodium arsenite increases expression ISO Sod3 (Mus musculus) 6480464 sodium arsenite results in increased expression of SOD3 mRNA CTD PMID:37682722 SOD3 Human sodium dichromate increases expression ISO Sod3 (Rattus norvegicus) 6480464 sodium bichromate results in increased expression of SOD3 mRNA CTD PMID:12325037 SOD3 Human streptozocin multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 cobaltiprotoporphyrin inhibits the reaction [Streptozocin results in decreased expression of SOD3 protein] more ... CTD PMID:15821039 and PMID:16973718 SOD3 Human streptozocin multiple interactions ISO Sod3 (Mus musculus) 6480464 [Streptozocin results in decreased activity of SOD3 protein] which results in increased chemical synthesis of Peroxynitrous Acid more ... CTD PMID:23884884 SOD3 Human streptozocin decreases expression ISO Sod3 (Rattus norvegicus) 6480464 Streptozocin results in decreased expression of SOD3 mRNA and Streptozocin results in decreased expression of SOD3 protein CTD PMID:15821039 and PMID:16973718 SOD3 Human sulfadimethoxine increases expression ISO Sod3 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of SOD3 mRNA CTD PMID:30047161 SOD3 Human sulfasalazine decreases expression ISO Sod3 (Mus musculus) 6480464 Sulfasalazine results in decreased expression of SOD3 mRNA CTD PMID:31830553 SOD3 Human sulfur dioxide multiple interactions EXP 6480464 [[Vehicle Emissions results in increased abundance of Soot] co-treated with [Air Pollutants results in increased abundance of [Sulfur Dioxide co-treated with Nitrogen Dioxide]]] results in increased expression of SOD3 mRNA CTD PMID:35736886 SOD3 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of SOD3 mRNA CTD PMID:31533062 SOD3 Human superoxide multiple interactions ISO Sod3 (Mus musculus) 6480464 [ATP7A protein results in increased activity of SOD3 protein] which results in decreased chemical synthesis of Superoxides more ... CTD PMID:16864745 and PMID:23884884 SOD3 Human tamibarotene decreases expression EXP 6480464 tamibarotene results in decreased expression of SOD3 mRNA CTD PMID:15498508 SOD3 Human tetrachloromethane affects expression ISO Sod3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SOD3 mRNA CTD PMID:17484886 SOD3 Human tetrachloromethane decreases expression ISO Sod3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of SOD3 mRNA CTD PMID:23341968 SOD3 Human tetrachloromethane multiple interactions ISO Sod3 (Mus musculus) 6480464 Glycyrrhetinic Acid inhibits the reaction [Carbon Tetrachloride results in decreased expression of SOD3 mRNA] CTD PMID:23341968 SOD3 Human thiabendazole multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of SOD3 mRNA CTD PMID:33854195 SOD3 Human thymoquinone multiple interactions ISO Sod3 (Rattus norvegicus) 6480464 thymoquinone inhibits the reaction [[Dietary Fats co-treated with Cholesterol and Dietary] results in decreased expression of SOD3 mRNA] CTD PMID:28734741 SOD3 Human titanium dioxide increases methylation ISO Sod3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SOD3 gene CTD PMID:35295148 SOD3 Human trans-isoeugenol increases expression EXP 6480464 isoeugenol results in increased expression of SOD3 mRNA CTD PMID:20566472 SOD3 Human triclosan decreases expression EXP 6480464 Triclosan results in decreased expression of SOD3 mRNA CTD PMID:30510588 SOD3 Human trimellitic anhydride decreases expression ISO Sod3 (Rattus norvegicus) 6480464 trimellitic anhydride results in decreased expression of SOD3 mRNA CTD PMID:21893156 SOD3 Human troglitazone decreases expression ISO Sod3 (Mus musculus) 6480464 troglitazone results in decreased expression of SOD3 mRNA CTD PMID:28973697 SOD3 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of SOD3 gene CTD PMID:29154799 SOD3 Human vancomycin increases expression ISO Sod3 (Mus musculus) 6480464 Vancomycin results in increased expression of SOD3 mRNA CTD PMID:18930951 SOD3 Human vinclozolin decreases expression ISO Sod3 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of SOD3 mRNA CTD PMID:23034163 SOD3 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of SOD3 mRNA CTD PMID:24714768
(+)-catechin (EXP) (-)-epigallocatechin 3-gallate (EXP) (E)-cinnamyl alcohol (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,2,2-tetramine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (ISO) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrolein (ISO) Actein (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) alpha-hexylcinnamaldehyde (EXP) amitrole (ISO) ammonium chloride (ISO) aristolochic acid A (EXP) arsenite(3-) (EXP) arsenous acid (EXP) asbestos (ISO) atorvastatin calcium (ISO) atrazine (ISO) azoxystrobin (ISO) Bandrowski's base (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (ISO) butylated hydroxyanisole (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) calcitriol (EXP) carbendazim (ISO) CGP 52608 (EXP) chloroethene (ISO) chlorogenic acid (EXP) chlorpyrifos (ISO) cholic acid (ISO) ciglitazone (ISO) cinnamyl alcohol (EXP) cisplatin (EXP,ISO) clofibrate (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cumene (ISO) D-glucose (ISO) DDT (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) diarsenic trioxide (EXP) diazinon (ISO) dibutyl phthalate (ISO) dimethyl sulfoxide (ISO) dioxygen (EXP,ISO) disulfiram (EXP) diuron (ISO) donepezil hydrochloride (ISO) doxorubicin (EXP,ISO) ellagic acid (EXP) epoxiconazole (ISO) ethanol (ISO) eugenol (EXP) fenthion (ISO) finasteride (ISO) flutamide (ISO) formaldehyde (EXP) fulvestrant (ISO) genistein (EXP,ISO) glucose (ISO) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) glyphosate (ISO) GW 4064 (EXP,ISO) GW 501516 (EXP) haloperidol (ISO) hexachlorobenzene (ISO) hyaluronic acid (ISO) hydrogen cyanide (ISO) hydrogen peroxide (EXP,ISO) imidacloprid (ISO) inulin (ISO) isoeugenol (EXP) ketamine (ISO) L-ascorbic acid (EXP,ISO) lead diacetate (ISO) lead(0) (ISO) losartan (ISO) lutein (ISO) lycopene (ISO) mercury dichloride (ISO) methotrexate (EXP) methyl tert-butyl ether (ISO) methylmercury chloride (ISO) mifepristone (ISO) N,N-diethyl-m-toluamide (ISO) N-acetyl-L-cysteine (ISO) N-phosphocreatine (ISO) nickel sulfate (EXP) nimesulide (ISO) nitrogen dioxide (EXP) ochratoxin A (EXP) Osajin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) paricalcitol (EXP) perfluorooctane-1-sulfonic acid (ISO) permethrin (ISO) peroxynitrous acid (ISO) phenobarbital (ISO) phosgene (ISO) phosphorus atom (EXP) phosphorus(.) (EXP) Pomiferin (EXP) potassium chromate (ISO) potassium cyanide (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) probucol (ISO) progesterone (ISO) puerarin (EXP) Pyridostigmine bromide (ISO) quercetin (EXP) raloxifene (ISO) resveratrol (EXP,ISO) Rosavin (EXP) rotenone (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium dichromate (ISO) streptozocin (ISO) sulfadimethoxine (ISO) sulfasalazine (ISO) sulfur dioxide (EXP) sunitinib (EXP) superoxide (ISO) tamibarotene (EXP) tetrachloromethane (ISO) thiabendazole (ISO) thymoquinone (ISO) titanium dioxide (ISO) trans-isoeugenol (EXP) triclosan (EXP) trimellitic anhydride (ISO) troglitazone (ISO) valproic acid (EXP) vancomycin (ISO) vinclozolin (ISO) zoledronic acid (EXP)
1.
Relationship of plasma extracellular-superoxide dismutase level with insulin resistance in type 2 diabetic patients.
Adachi T, etal., J Endocrinol. 2004 Jun;181(3):413-7.
2.
Transgenic extracellular superoxide dismutase protects postnatal alveolar epithelial proliferation and development during hyperoxia.
Auten RL, etal., Am J Physiol Lung Cell Mol Physiol. 2006 Jan;290(1):L32-40. Epub 2005 Aug 12.
3.
Role of extracellular superoxide dismutase in bleomycin-induced pulmonary fibrosis.
Bowler RP, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Apr;282(4):L719-26.
4.
Altered expression profile of superoxide dismutase isoforms in nasal polyps from nonallergic patients.
Cheng YK, etal., Laryngoscope. 2006 Mar;116(3):417-22.
5.
Gene transfer of extracellular superoxide dismutase reduces arterial pressure in spontaneously hypertensive rats: role of heparin-binding domain.
Chu Y, etal., Circ Res. 2003 Mar 7;92(4):461-8. Epub 2003 Jan 23.
6.
Long-term hyperglycaemia decreases vascular fraction of extracellular superoxide dismutase.
Ciechanowski K, etal., Diabetologia. 2003 Jul;46(7):1026-7. Epub 2003 Jun 27.
7.
Regulation of lung oxidative damage by endogenous superoxide dismutase in sepsis.
Constantino L, etal., Intensive Care Med Exp. 2014 Dec;2(1):17. doi: 10.1186/2197-425X-2-17. Epub 2014 May 23.
8.
Association of genetic polymorphisms in SOD2, SOD3, GPX3, and GSTT1 with hypertriglyceridemia and low HDL-C level in subjects with high risk of coronary artery disease.
Decharatchakul N, etal., PeerJ. 2019 Aug 1;7:e7407. doi: 10.7717/peerj.7407. eCollection 2019.
9.
Reduction of renal superoxide dismutase in progressive diabetic nephropathy.
Fujita H, etal., J Am Soc Nephrol. 2009 Jun;20(6):1303-13. Epub 2009 May 21.
10.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
11.
Role of extracellular superoxide dismutase in hypertension.
Gongora MC, etal., Hypertension. 2006 Sep;48(3):473-81. Epub 2006 Jul 24.
12.
Upregulation of vascular extracellular superoxide dismutase in patients with acute coronary syndromes.
Horiuchi M, etal., Arterioscler Thromb Vasc Biol. 2004 Jan;24(1):106-11. Epub 2003 Oct 30.
13.
Gene transfer of extracellular superoxide dismutase improves endothelial function in rats with heart failure.
Iida S, etal., Am J Physiol Heart Circ Physiol. 2005 Aug;289(2):H525-32.
14.
Vascular effects of a common gene variant of extracellular superoxide dismutase in heart failure.
Iida S, etal., Am J Physiol Heart Circ Physiol. 2006 Aug;291(2):H914-20.
15.
Genetically increased antioxidative protection and decreased chronic obstructive pulmonary disease.
Juul K, etal., Am J Respir Crit Care Med. 2006 Apr 15;173(8):858-64. Epub 2006 Jan 6.
16.
Genetically reduced antioxidative protection and increased ischemic heart disease risk: The Copenhagen City Heart Study.
Juul K, etal., Circulation. 2004 Jan 6;109(1):59-65. Epub 2003 Dec 8.
17.
Serum extracellular superoxide dismutase in patients with type 2 diabetes: relationship to the development of micro- and macrovascular complications.
Kimura F, etal., Diabetes Care. 2003 Apr;26(4):1246-50.
18.
Extracellular superoxide dismutase has a highly specific localization in idiopathic pulmonary fibrosis/usual interstitial pneumonia.
Kinnula VL, etal., Histopathology. 2006 Jul;49(1):66-74.
19.
Vascular extracellular superoxide dismutase activity in patients with coronary artery disease: relation to endothelium-dependent vasodilation.
Landmesser U, etal., Circulation. 2000 May 16;101(19):2264-70.
20.
Skeletal muscle reperfusion injury is enhanced in extracellular superoxide dismutase knockout mouse.
Park JW, etal., Am J Physiol Heart Circ Physiol. 2005 Jul;289(1):H181-7. Epub 2005 Mar 18.
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Mice overexpressing extracellular superoxide dismutase have increased resistance to global cerebral ischemia.
Sheng H, etal., Exp Neurol. 2000 Jun;163(2):392-8.
23.
Extracellular superoxide dismutase gene polymorphism is associated with insulin resistance and the susceptibility to type 2 diabetes.
Tamai M, etal., Diabetes Res Clin Pract. 2006 Feb;71(2):140-5. Epub 2005 Jun 28.
24.
Comparison of the effect of adenoviral delivery of three superoxide dismutase genes against hepatic ischemia-reperfusion injury.
Wheeler MD, etal., Hum Gene Ther. 2001 Dec 10;12(18):2167-77.
25.
Exacerbated pulmonary arterial hypertension and right ventricular hypertrophy in animals with loss of function of extracellular superoxide dismutase.
Xu D, etal., Hypertension. 2011 Aug;58(2):303-9. doi: 10.1161/HYPERTENSIONAHA.110.166819. Epub 2011 Jul 5.
26.
Extracellular superoxide dismutase functions as a major repressor of hypoxia-induced erythropoietin gene expression.
Zelko IN and Folz RJ, Endocrinology. 2005 Jan;146(1):332-40. Epub 2004 Sep 16.
27.
[Correlation of the polymorphism of EC-SOD and GSTM1 and smoking with oral cancer risk].
Zhang C, etal., Wei Sheng Yan Jiu. 2012 Jul;41(4):555-61.
28.
[Association of the SOD2 Ala(-9)Val and SOD3 Arg213Gly polymorphisms with diabetic polyneuropathy in patients with diabetes mellitus type 1]
Zotova EV, etal., Mol Biol (Mosk). 2003 May-Jun;37(3):404-8.
SOD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 24,795,573 - 24,800,842 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 24,789,912 - 24,800,842 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 24,797,195 - 24,802,464 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 24,406,183 - 24,411,565 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 24,472,323 - 24,478,733 NCBI Celera 4 25,246,551 - 25,251,936 (+) NCBI Celera Cytogenetic Map 4 p15.2 NCBI HuRef 4 24,139,594 - 24,144,972 (+) NCBI HuRef CHM1_1 4 24,796,442 - 24,801,824 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 24,777,502 - 24,782,774 (+) NCBI T2T-CHM13v2.0
Sod3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 52,521,146 - 52,527,080 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 52,521,133 - 52,528,760 (+) Ensembl GRCm39 Ensembl GRCm38 5 52,363,804 - 52,369,738 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 52,363,791 - 52,371,418 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 52,755,043 - 52,760,977 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 52,652,052 - 52,657,986 (+) NCBI MGSCv36 mm8 Celera 5 49,732,370 - 49,738,292 (+) NCBI Celera Cytogenetic Map 5 C1 NCBI cM Map 5 27.92 NCBI
Sod3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 62,822,865 - 62,828,602 (-) NCBI GRCr8 mRatBN7.2 14 58,610,104 - 58,615,845 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 58,609,958 - 58,615,990 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 63,014,801 - 63,020,544 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 64,328,499 - 64,334,244 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 60,725,263 - 60,731,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 60,958,583 - 60,971,143 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 60,958,592 - 60,964,324 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 61,071,304 - 61,083,776 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 63,381,447 - 63,387,180 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 63,383,838 - 63,389,571 (-) NCBI Celera 14 57,707,717 - 57,713,440 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
Sod3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955480 257,716 - 263,149 (-) NCBI ChiLan1.0 ChiLan1.0
SOD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 25,042,416 - 25,047,841 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 25,239,089 - 25,248,284 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 19,195,941 - 19,201,298 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 24,480,912 - 24,486,382 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 24,485,059 - 24,485,781 (+) Ensembl panpan1.1 panPan2
SOD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 85,382,698 - 85,387,144 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 85,382,484 - 85,387,455 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 87,896,595 - 87,901,009 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 86,357,866 - 86,362,385 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 86,357,992 - 86,359,248 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 85,490,694 - 85,495,210 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 85,596,388 - 85,600,748 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 85,980,631 - 85,986,057 (-) NCBI UU_Cfam_GSD_1.0
SOD3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 18,796,637 - 18,802,152 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 18,796,633 - 18,802,156 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 19,293,239 - 19,293,972 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SOD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 25,554,474 - 25,559,873 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 25,555,082 - 25,555,804 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 72,074,072 - 72,079,449 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sod3
.
Confirmed Target Of
MIR21 hsa-miR-21-5p Mirtarbase external_info Luciferase reporter assay Functional MTI 22836756 MIR21 hsa-miR-21-5p OncomiRDB external_info NA NA 22836756
Predicted Target Of
Count of predictions: 911 Count of miRNA genes: 575 Interacting mature miRNAs: 637 Transcripts: ENST00000382120, ENST00000593742, ENST00000598411 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597277960 GWAS1374034_H extracellular superoxide dismutase [Cu-Zn] measurement QTL GWAS1374034 (human) 9e-204 extracellular superoxide dismutase [Cu-Zn] measurement 4 24800212 24800213 Human 597300952 GWAS1397026_H extracellular superoxide dismutase [Cu-Zn] measurement QTL GWAS1397026 (human) 4e-140 extracellular superoxide dismutase [Cu-Zn] measurement 4 24800212 24800213 Human 597120709 GWAS1216783_H blood protein measurement QTL GWAS1216783 (human) 3e-21 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 4 24800212 24800213 Human 597263450 GWAS1359524_H superoxide dismutase [Cu-Zn] measurement QTL GWAS1359524 (human) 2e-99 superoxide dismutase [Cu-Zn] measurement 4 24800212 24800213 Human 597171787 GWAS1267861_H protein measurement QTL GWAS1267861 (human) 1e-413 protein measurement 4 24800212 24800213 Human 597171788 GWAS1267862_H protein measurement QTL GWAS1267862 (human) 8e-17 protein measurement 4 24799693 24799694 Human 597122491 GWAS1218565_H blood protein measurement QTL GWAS1218565 (human) 4e-13 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 4 24800212 24800213 Human 597122762 GWAS1218836_H blood protein measurement QTL GWAS1218836 (human) 5e-33 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 4 24800212 24800213 Human 597172743 GWAS1268817_H protein measurement QTL GWAS1268817 (human) 1e-14 protein measurement 4 24800212 24800213 Human
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2405
2788
2232
4937
1717
2282
6
621
1339
462
2244
6683
5875
28
3712
1
842
1717
1549
170
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000382120 ⟹ ENSP00000371554
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 24,795,573 - 24,800,842 (+) Ensembl
Ensembl Acc Id:
ENST00000593742
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 24,789,947 - 24,790,606 (+) Ensembl
Ensembl Acc Id:
ENST00000598411 ⟹ ENSP00000472134
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 24,789,912 - 24,799,683 (+) Ensembl
RefSeq Acc Id:
NM_003102 ⟹ NP_003093
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 24,795,573 - 24,800,842 (+) NCBI GRCh37 4 24,797,085 - 24,802,467 (+) ENTREZGENE Build 36 4 24,406,183 - 24,411,565 (+) NCBI Archive HuRef 4 24,139,594 - 24,144,972 (+) ENTREZGENE CHM1_1 4 24,796,442 - 24,801,824 (+) NCBI T2T-CHM13v2.0 4 24,777,502 - 24,782,774 (+) NCBI
Sequence:
AGGGACAGCCTGCGTTCCTGGGCTGGCTGGGTGCAGCTCTCTTTTCAGGAGAGAAAGCTCTCTTGGAGGAGCTGGAAAGGTGCCCGACTCCAGCCATGCTGGCGCTACTGTGTTCCTGCCTGCTCCTG
hide sequence
RefSeq Acc Id:
XR_008487025
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 4 24,777,502 - 24,782,774 (+) NCBI
RefSeq Acc Id:
XR_427488
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 24,795,573 - 24,800,842 (+) NCBI
Sequence:
GCTTTTCCTCCCTGAACTGGCCCAATGACTGGCTCCCTCACGCTGACCACTCCTCTGGGCTGGC
hide sequence
RefSeq Acc Id:
NP_003093 ⟸ NM_003102
- Peptide Label:
preproprotein
- UniProtKB:
Q5U781 (UniProtKB/Swiss-Prot), Q6FHA2 (UniProtKB/Swiss-Prot), P08294 (UniProtKB/Swiss-Prot), A0A140VJU8 (UniProtKB/TrEMBL), B2R9V7 (UniProtKB/TrEMBL)
- Sequence:
MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCEST
hide sequence
Ensembl Acc Id:
ENSP00000472134 ⟸ ENST00000598411
Ensembl Acc Id:
ENSP00000371554 ⟸ ENST00000382120
RGD ID: 6867142 Promoter ID: EPDNEW_H6736 Type: initiation region Name: SOD3_1 Description: superoxide dismutase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 24,795,586 - 24,795,646 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-01-17
SOD3
superoxide dismutase 3
SOD3
superoxide dismutase 3, extracellular
Symbol and/or name change
5135510 APPROVED
