Psma2 (proteasome 20S subunit alpha 2)

Advanced Search (OLGA)

Gene: Psma2 (proteasome 20S subunit alpha 2) Rattus norvegicus

Analyze

Symbol:

Psma2

Name:

proteasome 20S subunit alpha 2

RGD ID:

61842

Description:

Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process and response to virus. Predicted to be located in P-body. Predicted to be part of proteasome core complex, alpha-subunit complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human PSMA2 (proteasome 20S subunit alpha 2); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

macropain subunit C3; multicatalytic endopeptidase complex subunit C3; proteasome (prosome, macropain) subunit, alpha type 2; proteasome alpha 2 subunit; proteasome component C3; proteasome subunit alpha 2; proteasome subunit alpha type-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMA2 (proteasome 20S subunit alpha 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Psma2 (proteasome subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psma2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMA2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMA2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psma2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMA2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMA2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psma2 (proteasome 20S subunit alpha 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SOD3 (superoxide dismutase 3)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Psma2 (proteasome subunit alpha 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PSMA2 (proteasome 20S subunit alpha 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	psma2 (proteasome subunit alpha 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:rp71-45k5.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRE8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosalpha2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pas-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psma2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	55,250,054 - 55,260,441 (-)	NCBI		GRCr8
mRatBN7.2	17	50,554,536 - 50,564,923 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	50,551,924 - 50,564,938 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	53,727,450 - 53,737,840 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	57,730,369 - 57,740,759 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	51,831,487 - 51,841,878 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	53,091,937 - 53,102,324 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	53,091,933 - 53,102,342 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	50,791,696 - 50,802,083 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	58,736,300 - 58,746,837 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	58,739,140 - 58,749,678 (-)	NCBI
Celera	17	46,587,061 - 46,597,448 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

heart disease (ISO)

osteoporosis (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-nitrofluorene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

aflatoxin B1 (EXP,ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

calcidiol (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenzo[a,l]pyrene (ISO)

dichlorine (EXP)

dicrotophos (ISO)

diethylstilbestrol (EXP,ISO)

dioxygen (ISO)

disodium selenite (ISO)

diuron (ISO)

doxorubicin (ISO)

epoxomicin (ISO)

ethanol (ISO)

fenvalerate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

genistein (EXP)

gentamycin (EXP)

hydralazine (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

methamphetamine (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

Nonylphenol (EXP)

oxidopamine (EXP)

ozone (EXP,ISO)

paracetamol (ISO)

patulin (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

PhIP (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

sodium dodecyl sulfate (ISO)

sunitinib (ISO)

temozolomide (ISO)

thapsigargin (ISO)

trichloroethene (EXP)

tungsten (ISO)

tunicamycin (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

proteolysis involved in protein catabolic process (IEA)

response to virus (ISO)

Cellular Component

cytoplasm (ISO)

nucleus (IEA,ISO)

P-body (ISO,ISS)

proteasome complex (ISO)

proteasome core complex (ISO,ISS)

proteasome core complex, alpha-subunit complex (IBA,IEA,ISS)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Molecular cloning of cDNA for proteasomes from rat liver: primary structure of component C3 with a possible tyrosine phosphorylation site.	Tanaka K, etal., Biochemistry 1990 Apr 17;29(15):3777-85.
7.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:2335242	PMID:8794741	PMID:12477932	PMID:16548883	PMID:16857966	PMID:17323924	PMID:19056867	PMID:19638347	PMID:20458337	PMID:20498273	PMID:21630459	PMID:22078707
PMID:22486777	PMID:22793692	PMID:22871113	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Psma2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	55,250,054 - 55,260,441 (-)	NCBI		GRCr8
mRatBN7.2	17	50,554,536 - 50,564,923 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	50,551,924 - 50,564,938 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	53,727,450 - 53,737,840 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	57,730,369 - 57,740,759 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	51,831,487 - 51,841,878 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	53,091,937 - 53,102,324 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	53,091,933 - 53,102,342 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	50,791,696 - 50,802,083 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	58,736,300 - 58,746,837 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	58,739,140 - 58,749,678 (-)	NCBI
Celera	17	46,587,061 - 46,597,448 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

PSMA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	42,916,861 - 42,932,174 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	42,916,828 - 42,932,185 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	42,956,460 - 42,971,773 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	42,922,985 - 42,938,330 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	42,729,700 - 42,745,045	NCBI
Celera	7	42,946,778 - 42,962,112 (-)	NCBI		Celera
Cytogenetic Map	7	p14.1	NCBI
HuRef	7	42,841,274 - 42,856,609 (-)	NCBI		HuRef
CHM1_1	7	42,960,019 - 42,975,351 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	43,075,002 - 43,090,304 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	42,995,968 - 43,011,303 (-)	NCBI

Psma2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	14,787,827 - 14,800,258 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	14,787,825 - 14,848,821 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	14,613,242 - 14,625,673 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	14,613,240 - 14,674,236 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	14,705,509 - 14,717,940 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	14,405,401 - 14,417,713 (+)	NCBI		MGSCv36	mm8
Celera	13	14,919,628 - 14,931,949 (+)	NCBI		Celera
Cytogenetic Map	13	A1	NCBI
cM Map	13	5.36	NCBI

Psma2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	880,715 - 893,979 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	880,795 - 890,718 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSMA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	45,503,681 - 45,518,762 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	93,828,424 - 93,843,505 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	41,304,746 - 41,319,844 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	41,348,365 - 41,363,986 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	41,348,364 - 41,363,986 (+)	Ensembl	panpan1.1		panPan2

PSMA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	7,218,150 - 7,228,859 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	7,218,080 - 7,228,816 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	7,069,068 - 7,079,673 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	7,265,160 - 7,275,772 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	7,265,190 - 7,276,282 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	7,248,213 - 7,258,815 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	7,217,467 - 7,228,072 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	7,330,266 - 7,340,870 (+)	NCBI		UU_Cfam_GSD_1.0

Psma2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	98,871,794 - 98,883,420 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	18,079,863 - 18,095,117 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	18,083,525 - 18,095,088 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	51,909,473 - 51,921,238 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	51,909,399 - 51,919,859 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	56,857,703 - 56,868,258 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	15,672,115 - 15,686,492 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	15,672,106 - 15,687,177 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666062	6,801,709 - 6,816,662 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psma2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	18,230,800 - 18,241,399 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	18,231,152 - 18,241,403 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Psma2
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	885
Count of miRNA genes:	322
Interacting mature miRNAs:	420
Transcripts:	ENSRNOT00000073834
Prediction methods:	Microtar, Miranda, Pita
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073834 ⟹ ENSRNOP00000066950

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	50,551,924 - 50,564,938 (-)	Ensembl
Rnor_6.0 Ensembl	17	53,091,933 - 53,102,342 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114023 ⟹ ENSRNOP00000083039

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	50,551,924 - 50,563,629 (-)	Ensembl

RefSeq Acc Id:

NM_017279 ⟹ NP_058975

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	55,250,054 - 55,260,441 (-)	NCBI
mRatBN7.2	17	50,554,536 - 50,564,923 (-)	NCBI
Rnor_6.0	17	53,091,937 - 53,102,324 (-)	NCBI
Rnor_5.0	17	50,791,696 - 50,802,083 (-)	NCBI
RGSC_v3.4	17	58,736,300 - 58,746,837 (-)	RGD
Celera	17	46,587,061 - 46,597,448 (-)	RGD

Sequence:

show sequence

GTAAAGATGGCAGAACGCGGTTACAGCTTCTCGCTGACTACATTCAGCCCATCTGGTAAACTTG
TGCAGATTGAATATGCTTTGGCCGCTGTAGCTGGAGGGGCCCCTTCAGTGGGAATTAAAGCTGC
AAATGGCGTGGTATTAGCCACTGAGAAAAAGCAGAAATCCATCCTGTATGATGAGAGGAGTGTA
CACAAAGTGGAGCCCATAACCAAGCACATCGGTTTGGTGTACAGCGGCATGGGTCCAGATTACA
GAGTCCTTGTACACAGAGCTCGGAAACTTGCTCAGCAGTACTACCTTGTTTACCAAGAACCCAT
TCCCACAGCCCAACTGGTACAGCGAGTAGCGTCTGTGATGCAAGAGTATACCCAGTCAGGTGGT
GTTCGTCCATTTGGTGTTTCTTTACTTATTTGTGGGTGGAATGAGGGACGACCATATTTATTTC
AGTCAGATCCATCTGGAGCTTACTTTGCCTGGAAGGCCACAGCAATGGGAAAGAACTACGTGAA
CGGGAAAACTTTCCTTGAGAAAAGATATAATGAAGACTTAGAACTGGAAGATGCGATTCACACA
GCCATCTTAACCCTTAAGGAAAGCTTTGAAGGGCAGATGACAGAAGATAACATAGAAGTTGGGA
TCTGCAATGAAGCTGGCTTTAGGAGGCTCACCCCAACTGAAGTGAGGGATTACTTGGCTGCTAT
AGCGTAATGAAGATGTGCCGGAACAACAAGGAACACTCATTCTACTTATTCATTTTTAAAGTAT
GTTTTGTTTGTGCAGACTTATTTCTACATGCTTTAATGGATTTCACATTTTTAAATAATAATCA
TAATAAACTGTTAAAACCAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_058975	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40838	(Get FASTA)	NCBI Sequence Viewer
	AAH60576	(Get FASTA)	NCBI Sequence Viewer
	EDL87415	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066950.1
	ENSRNOP00000083039.1
	ENSRNOP00055015164
	ENSRNOP00060019897
	ENSRNOP00065024667
GenBank Protein	P17220	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058975 ⟸ NM_017279

- UniProtKB:

P17220 (UniProtKB/Swiss-Prot), A6K9C2 (UniProtKB/TrEMBL), Q6P9V5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHK
VEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVR
PFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAI
LTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA

hide sequence

Ensembl Acc Id:

ENSRNOP00000066950 ⟸ ENSRNOT00000073834

Ensembl Acc Id:

ENSRNOP00000083039 ⟸ ENSRNOT00000114023

Protein Domains

Proteasome alpha-type subunits

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17220-F1-model_v2	AlphaFold	P17220	1-234	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700514

Promoter ID:

EPDNEW_R11037

Type:

multiple initiation site

Name:

Psma2_1

Description:

proteasome subunit alpha 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	53,102,339 - 53,102,399	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61842	AgrOrtholog
BioCyc Gene	G2FUF-9070	BioCyc
Ensembl Genes	ENSRNOG00000049920	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055011092	UniProtKB/Swiss-Prot
	ENSRNOG00060014611	UniProtKB/Swiss-Prot
	ENSRNOG00065018439	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073834.3	UniProtKB/Swiss-Prot
	ENSRNOT00000114023.1	UniProtKB/TrEMBL
	ENSRNOT00055018805	UniProtKB/Swiss-Prot
	ENSRNOT00060024971	UniProtKB/Swiss-Prot
	ENSRNOT00065030966	UniProtKB/Swiss-Prot
Gene3D-CATH	3.60.20.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6919255	IMAGE-MGC_LOAD
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_alpha-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_asu_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_sua/b	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29669	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72879	IMAGE-MGC_LOAD
NCBI Gene	29669	ENTREZGENE
PANTHER	PROTEASOME SUBUNIT ALPHA/BETA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11599:SF16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Proteasome	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_A_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Psma2	PhenoGen
PROSITE	PROTEASOME_ALPHA_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEASOME_ALPHA_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049920	RatGTEx
	ENSRNOG00055011092	RatGTEx
	ENSRNOG00060014611	RatGTEx
	ENSRNOG00065018439	RatGTEx
SMART	Proteasome_A_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204254
UniProt	A0A8I5ZV22_RAT	UniProtKB/TrEMBL
	A6K9C2	ENTREZGENE, UniProtKB/TrEMBL
	P17220	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6P9V5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Psma2	proteasome 20S subunit alpha 2	Psma2	proteasome subunit alpha 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-08-19	Psma2	proteasome subunit alpha 2	Psma2	proteasome (prosome, macropain) subunit, alpha type 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Psma2	proteasome (prosome, macropain) subunit, alpha type 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)