Symbol:
KYNU
Name:
kynureninase
RGD ID:
734173
HGNC Page
HGNC:6469
Description:
Enables kynureninase activity and protein homodimerization activity. Involved in several processes, including aromatic amino acid metabolic process; quinolinate biosynthetic process; and response to type II interferon. Located in cytosol; mitochondrion; and nucleoplasm. Implicated in hydroxykynureninuria.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
kynureninase (L-kynurenine hydrolase); KYNUU; l-kynurenine hydrolase; VCRL2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Kynu (kynureninase) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Kynu (kynureninase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Kynu (kynureninase) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
KYNU (kynureninase) NCBI
Ortholog
Canis lupus familiaris (dog):
KYNU (kynureninase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kynu (kynureninase) NCBI
Ortholog
Sus scrofa (pig):
KYNU (kynureninase) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
KYNU (kynureninase) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Kynu (kynureninase) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Kynu (kynureninase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kynu (kynureninase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kynu (kynureninase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
BNA5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
kynu-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
kynu.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
KYNUP1
KYNUP2
KYNUP3
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 142,877,664 - 143,055,833 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 142,877,657 - 143,055,833 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 143,635,233 - 143,813,402 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 143,351,665 - 143,516,355 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 143,468,950 - 143,633,606 NCBI Celera 2 137,347,656 - 137,512,293 (+) NCBI Celera Cytogenetic Map 2 q22.2 NCBI HuRef 2 135,626,307 - 135,791,074 (+) NCBI HuRef CHM1_1 2 143,640,202 - 143,804,900 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 143,325,958 - 143,504,091 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
KYNU Human autosomal dominant intellectual developmental disorder 1 IAGP RGD:12892094 8554872 ClinVar Annotator: match by term: MBD5 associated neurodevelopmental disorder ClinVar PMID:21981781|PMID:23632792 KYNU Human Catel Manzke syndrome IAGP RGD:39457660 8554872 ClinVar Annotator: match by term: MICROGNATHIA DIGITAL SYNDROME ClinVar PMID:25741868|PMID:31923704|PMID:33942433 KYNU Human Catel Manzke syndrome IAGP RGD:39457659|RGD:39457661|RGD:39457662 8554872 ClinVar Annotator: match by term: Catel-Manzke syndrome ClinVar PMID:25741868|PMID:31923704 KYNU Human hydroxykynureninuria IAGP RGD:150521456|RGD:597663866|RGD:597663878 8554872 ClinVar Annotator: match by term: Hydroxykynureninuria ClinVar PMID:25741868 KYNU Human hydroxykynureninuria IAGP RGD:15139653|RGD:15195272 8554872 ClinVar Annotator: match by term: KYNU-related condition ClinVar PMID:28492532 KYNU Human hydroxykynureninuria IAGP RGD:9684490 8554872 ClinVar Annotator: match by term: Hydroxykynureninuria ClinVar PMID:17334708 KYNU Human hydroxykynureninuria IAGP RGD:152982450 8554872 ClinVar Annotator: match by term: Hydroxykynureninuria ClinVar KYNU Human Mowat-Wilson syndrome IAGP RGD:38457691 8554872 ClinVar Annotator: match by term: Mowat-Wilson syndrome ClinVar KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:13210861|RGD:13210880|RGD:13210899 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:25741868|PMID:28792876 KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:150542693 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:17334708|PMID:25741868|PMID:28492532|PMID:28792876|PMID:31923704|PMID:34200361 KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:127274272|RGD:127274273|RGD:127274274|RGD:127274275 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:33942433 KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:150521456|RGD:151348713|RGD:151349568|RGD:401769698|RGD:401828946|RGD:405706064 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:25741868 KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:153301506 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:34200361 KYNU Human Vertebral, Cardiac, Renal, and Limb Defects Syndrome 2 IAGP RGD:9684516 8554872 ClinVar Annotator: match by term: Vertebral, cardiac, renal, and limb defects syndrome 2 ClinVar PMID:11204305|PMID:22012986
Only show annotations with direct experimental evidence (0 objects hidden)
KYNU Human (+)-schisandrin B multiple interactions ISO RGD:71061 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of KYNU mRNA] CTD PMID:31150632 KYNU Human (-)-demecolcine increases expression EXP 6480464 Demecolcine results in increased expression of KYNU mRNA CTD PMID:23649840 KYNU Human (1->4)-beta-D-glucan multiple interactions ISO RGD:737184 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KYNU mRNA CTD PMID:36331819 KYNU Human 1,2-dimethylhydrazine increases expression ISO RGD:737184 6480464 1,2-Dimethylhydrazine results in increased expression of KYNU mRNA CTD PMID:22206623 KYNU Human 1-benzylpiperazine decreases expression ISO RGD:71061 6480464 N-benzylpiperazine results in decreased expression of KYNU mRNA CTD PMID:26821219 KYNU Human 1-naphthyl isothiocyanate decreases expression ISO RGD:71061 6480464 1-Naphthylisothiocyanate results in decreased expression of KYNU mRNA CTD PMID:25380136|PMID:30723492 KYNU Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of KYNU mRNA CTD PMID:20660070 KYNU Human 17beta-estradiol increases expression ISO RGD:737184 6480464 Estradiol results in increased expression of KYNU mRNA CTD PMID:39298647 KYNU Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KYNU mRNA CTD PMID:21185374|PMID:26865669|PMID:28711546 KYNU Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:737184 6480464 Tetrachlorodibenzodioxin results in decreased expression of KYNU mRNA CTD PMID:18796159 KYNU Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:71061 6480464 Tetrachlorodibenzodioxin results in decreased expression of KYNU mRNA CTD PMID:19692669|PMID:21215274|PMID:21724226 KYNU Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:71061 6480464 Tetrachlorodibenzodioxin affects the expression of KYNU mRNA CTD PMID:22298810 KYNU Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:737184 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of KYNU mRNA CTD PMID:16214954 KYNU Human 2,4-dinitrotoluene affects expression ISO RGD:71061 6480464 2,4-dinitrotoluene affects the expression of KYNU mRNA CTD PMID:21346803 KYNU Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:71061 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of KYNU mRNA CTD PMID:19692669 KYNU Human 3-chloropropane-1,2-diol decreases expression ISO RGD:71061 6480464 alpha-Chlorohydrin results in decreased expression of KYNU protein CTD PMID:34915118 KYNU Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:71061 6480464 4,4'-diaminodiphenylmethane results in decreased expression of KYNU mRNA CTD PMID:25380136 KYNU Human 4,4'-sulfonyldiphenol increases expression ISO RGD:737184 6480464 bisphenol S results in increased expression of KYNU mRNA CTD PMID:39298647 KYNU Human acetamide decreases expression ISO RGD:71061 6480464 acetamide results in decreased expression of KYNU mRNA CTD PMID:31881176 KYNU Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KYNU protein CTD PMID:38460933 KYNU Human aflatoxin B1 decreases expression ISO RGD:737184 6480464 Aflatoxin B1 results in decreased expression of KYNU mRNA CTD PMID:19770486 KYNU Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of KYNU gene CTD PMID:27153756 KYNU Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of KYNU mRNA CTD PMID:27153756 KYNU Human aldehydo-D-glucose multiple interactions ISO RGD:737184 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 KYNU Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of KYNU mRNA CTD PMID:16249480|PMID:33167477 KYNU Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of KYNU mRNA CTD PMID:24449571 KYNU Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of KYNU mRNA CTD PMID:33212167 KYNU Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of KYNU mRNA CTD PMID:15761015|PMID:36801614 KYNU Human atazanavir sulfate multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human azathioprine increases expression EXP 6480464 Azathioprine results in increased expression of KYNU mRNA CTD PMID:22623647 KYNU Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KYNU mRNA CTD PMID:21632981 KYNU Human beta-naphthoflavone multiple interactions ISO RGD:71061 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of KYNU mRNA CTD PMID:18164116 KYNU Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of KYNU mRNA CTD PMID:19737606 KYNU Human bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of KYNU mRNA CTD PMID:25102026 KYNU Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KYNU mRNA CTD PMID:28711546 KYNU Human bisphenol A increases expression ISO RGD:737184 6480464 bisphenol A results in increased expression of KYNU mRNA CTD PMID:38701888 KYNU Human bisphenol A increases expression ISO RGD:71061 6480464 bisphenol A results in increased expression of KYNU mRNA CTD PMID:32145629 KYNU Human bisphenol A affects expression ISO RGD:71061 6480464 bisphenol A affects the expression of KYNU mRNA CTD PMID:30903817 KYNU Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KYNU mRNA CTD PMID:29275510 KYNU Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KYNU mRNA CTD PMID:30903817 KYNU Human bisphenol A increases methylation ISO RGD:71061 6480464 bisphenol A results in increased methylation of KYNU gene CTD PMID:28505145 KYNU Human bisphenol A decreases expression ISO RGD:71061 6480464 bisphenol A results in decreased expression of KYNU mRNA CTD PMID:25181051 KYNU Human bromuconazole decreases expression ISO RGD:71061 6480464 bromuconazole results in decreased expression of KYNU mRNA CTD PMID:33789219 KYNU Human buta-1,3-diene decreases expression ISO RGD:737184 6480464 1,3-butadiene results in decreased expression of KYNU mRNA CTD PMID:29038090 KYNU Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of KYNU mRNA CTD PMID:21172416 KYNU Human cadmium dichloride decreases expression ISO RGD:71061 6480464 Cadmium Chloride results in decreased expression of KYNU mRNA CTD PMID:25993096 KYNU Human cantharidin increases expression ISO RGD:737184 6480464 Cantharidin results in increased expression of KYNU mRNA CTD PMID:36907384 KYNU Human carbon nanotube decreases expression ISO RGD:737184 6480464 Nanotubes, Carbon analog results in decreased expression of KYNU mRNA CTD PMID:25620056 KYNU Human carbon nanotube increases expression ISO RGD:737184 6480464 Nanotubes, Carbon analog results in increased expression of KYNU mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 KYNU Human chenodeoxycholic acid multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human chloropicrin increases expression EXP 6480464 chloropicrin results in increased expression of KYNU mRNA CTD PMID:26352163 KYNU Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:38479592 KYNU Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of KYNU mRNA CTD PMID:27392435 KYNU Human clomiphene increases expression EXP 6480464 Clomiphene results in increased expression of KYNU mRNA CTD PMID:26865669 KYNU Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of KYNU mRNA CTD PMID:19376846 KYNU Human copper atom decreases expression ISO RGD:71061 6480464 Copper results in decreased expression of KYNU mRNA CTD PMID:22465980 KYNU Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of KYNU mRNA CTD PMID:20971185 KYNU Human copper(0) decreases expression ISO RGD:71061 6480464 Copper results in decreased expression of KYNU mRNA CTD PMID:22465980 KYNU Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of KYNU mRNA CTD PMID:20971185 KYNU Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of KYNU mRNA CTD PMID:38568856 KYNU Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of KYNU mRNA CTD PMID:19549813 KYNU Human coumarin decreases expression ISO RGD:71061 6480464 coumarin results in decreased expression of KYNU mRNA CTD PMID:18480146 KYNU Human crocidolite asbestos increases expression EXP 6480464 Asbestos, Crocidolite results in increased expression of KYNU mRNA CTD PMID:24160326|PMID:25351596 KYNU Human crocidolite asbestos decreases expression ISO RGD:737184 6480464 Asbestos, Crocidolite results in decreased expression of KYNU mRNA CTD PMID:29279043 KYNU Human crocidolite asbestos affects expression EXP 6480464 Asbestos, Crocidolite affects the expression of KYNU mRNA CTD PMID:25757056 KYNU Human curcumin increases expression EXP 6480464 Curcumin results in increased expression of KYNU mRNA CTD PMID:18421014 KYNU Human cyanocob(III)alamin multiple interactions ISO RGD:71061 6480464 [Folic Acid co-treated with Vitamin B 12] inhibits the reaction [Rotenone results in decreased expression more ... CTD PMID:36553663 KYNU Human cyclosporin A decreases expression ISO RGD:737184 6480464 Cyclosporine results in decreased expression of KYNU mRNA CTD PMID:19770486 KYNU Human cyclosporin A multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of KYNU mRNA CTD PMID:20106945|PMID:25562108|PMID:34681664 KYNU Human cypermethrin decreases activity ISO RGD:737184 6480464 cypermethrin results in decreased activity of KYNU protein CTD PMID:7175100 KYNU Human cytarabine decreases expression EXP 6480464 Cytarabine results in decreased expression of KYNU mRNA CTD PMID:21198554 KYNU Human D-glucose multiple interactions ISO RGD:737184 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 KYNU Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of KYNU mRNA CTD PMID:38568856 KYNU Human deoxycholic acid multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of KYNU mRNA CTD PMID:15761015|PMID:36801614 KYNU Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of KYNU mRNA CTD PMID:37042841 KYNU Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of KYNU mRNA CTD PMID:28302478 KYNU Human diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of KYNU mRNA CTD PMID:26865669 KYNU Human diquat increases expression EXP 6480464 Diquat results in increased expression of KYNU mRNA CTD PMID:21172416 KYNU Human diquat increases expression ISO RGD:737184 6480464 Diquat results in increased expression of KYNU mRNA CTD PMID:36851058 KYNU Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 KYNU Human endosulfan decreases expression ISO RGD:71061 6480464 Endosulfan results in decreased expression of KYNU mRNA CTD PMID:29391264 KYNU Human epoxiconazole decreases expression ISO RGD:737184 6480464 epoxiconazole results in decreased expression of KYNU mRNA CTD PMID:35436446 KYNU Human estrone decreases expression EXP 6480464 Estrone results in decreased expression of KYNU mRNA CTD PMID:26865669 KYNU Human etoposide affects response to substance EXP 6480464 KYNU protein affects the susceptibility to Etoposide CTD PMID:16217747 KYNU Human fenvalerate decreases activity ISO RGD:737184 6480464 fenvalerate results in decreased activity of KYNU protein CTD PMID:7175102 KYNU Human flavonoids decreases expression ISO RGD:71061 6480464 Flavonoids results in decreased expression of KYNU mRNA CTD PMID:18035473 KYNU Human flutamide decreases expression ISO RGD:71061 6480464 Flutamide results in decreased expression of KYNU mRNA CTD PMID:24136188|PMID:24793618 KYNU Human folic acid multiple interactions ISO RGD:71061 6480464 [Folic Acid co-treated with Vitamin B 12] inhibits the reaction [Rotenone results in decreased expression more ... CTD PMID:36553663 KYNU Human fructose multiple interactions ISO RGD:737184 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 KYNU Human fulvestrant increases expression EXP 6480464 fulvestrant results in increased expression of KYNU mRNA CTD PMID:26865669 KYNU Human furan decreases expression ISO RGD:71061 6480464 furan results in decreased expression of KYNU mRNA CTD PMID:25539665|PMID:26194646 KYNU Human gamma-linolenic acid decreases expression EXP 6480464 gamma-Linolenic Acid results in decreased expression of KYNU mRNA CTD PMID:20664735 KYNU Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of KYNU mRNA CTD PMID:26865669 KYNU Human glafenine decreases expression ISO RGD:71061 6480464 Glafenine results in decreased expression of KYNU mRNA CTD PMID:24136188 KYNU Human glucose multiple interactions ISO RGD:737184 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ... CTD PMID:37567420 KYNU Human glycidyl methacrylate decreases expression EXP 6480464 glycidyl methacrylate results in decreased expression of KYNU protein CTD PMID:36641056 KYNU Human glycochenodeoxycholic acid multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human glycocholic acid multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human glycodeoxycholic acid multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human gold atom increases expression EXP 6480464 Gold results in increased expression of KYNU mRNA CTD PMID:29705079 KYNU Human gold(0) increases expression EXP 6480464 Gold results in increased expression of KYNU mRNA CTD PMID:29705079 KYNU Human GW 4064 increases expression ISO RGD:737184 6480464 GW 4064 results in increased expression of KYNU mRNA CTD PMID:26655953 KYNU Human hexestrol decreases expression EXP 6480464 Hexestrol results in decreased expression of KYNU mRNA CTD PMID:26865669 KYNU Human hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of KYNU mRNA CTD PMID:18951874 KYNU Human indometacin decreases expression ISO RGD:71061 6480464 Indomethacin results in decreased expression of KYNU mRNA CTD PMID:36868495 KYNU Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of KYNU protein CTD PMID:32959892 KYNU Human kynurenine increases expression EXP 6480464 Kynurenine results in increased expression of KYNU mRNA CTD PMID:32781018 KYNU Human lamivudine multiple interactions EXP 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of KYNU mRNA CTD PMID:15784690 KYNU Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of KYNU mRNA CTD PMID:35811015 KYNU Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KYNU mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 KYNU Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of KYNU mRNA CTD PMID:20044591 KYNU Human mercury dichloride decreases expression ISO RGD:71061 6480464 Mercuric Chloride results in decreased expression of KYNU mRNA CTD PMID:16507785 KYNU Human mestranol decreases expression EXP 6480464 Mestranol results in decreased expression of KYNU mRNA CTD PMID:26865669 KYNU Human methamphetamine decreases expression ISO RGD:737184 6480464 Methamphetamine results in decreased expression of KYNU mRNA CTD PMID:26307267 KYNU Human methapyrilene decreases expression ISO RGD:71061 6480464 Methapyrilene results in decreased expression of KYNU mRNA CTD PMID:16393664 KYNU Human methomyl decreases activity ISO RGD:737184 6480464 Methomyl results in decreased activity of KYNU protein CTD PMID:7175100 KYNU Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of KYNU mRNA CTD PMID:23179753 KYNU Human N,N-diethyl-m-toluamide multiple interactions ISO RGD:71061 6480464 [Permethrin co-treated with DEET] results in increased methylation of KYNU gene CTD PMID:33148267 KYNU Human N-nitrosodiethylamine multiple interactions ISO RGD:71061 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of KYNU mRNA; [Diethylnitrosamine co-treated with Thioacetamide] more ... CTD PMID:18164116|PMID:28943392 KYNU Human N-nitrosodimethylamine decreases expression ISO RGD:71061 6480464 Dimethylnitrosamine results in decreased expression of KYNU mRNA CTD PMID:25380136 KYNU Human nefazodone decreases expression ISO RGD:71061 6480464 nefazodone results in decreased expression of KYNU mRNA CTD PMID:24136188 KYNU Human nefazodone multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of KYNU mRNA CTD PMID:24768652|PMID:25583101 KYNU Human nickel dichloride increases expression EXP 6480464 nickel chloride results in increased expression of KYNU mRNA CTD PMID:17312168 KYNU Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of KYNU mRNA CTD PMID:22714537 KYNU Human nimesulide decreases expression ISO RGD:71061 6480464 nimesulide results in decreased expression of KYNU mRNA CTD PMID:24136188 KYNU Human nitroglycerin decreases expression ISO RGD:71061 6480464 Nitroglycerin results in decreased expression of KYNU protein CTD PMID:28659861 KYNU Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KYNU protein CTD PMID:38460933 KYNU Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of KYNU mRNA; Okadaic Acid results in increased expression more ... CTD PMID:38832940 KYNU Human ozone multiple interactions ISO RGD:737184 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 KYNU Human p-toluidine decreases expression ISO RGD:71061 6480464 4-toluidine results in decreased expression of KYNU mRNA CTD PMID:27638505 KYNU Human paracetamol affects expression ISO RGD:737184 6480464 Acetaminophen affects the expression of KYNU mRNA CTD PMID:17562736 KYNU Human paracetamol multiple interactions EXP 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 KYNU Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KYNU mRNA CTD PMID:21420995|PMID:25704631|PMID:29067470 KYNU Human paraquat increases expression EXP 6480464 Paraquat results in increased expression of KYNU mRNA CTD PMID:34681664 KYNU Human perfluorooctane-1-sulfonic acid decreases expression ISO RGD:71061 6480464 perfluorooctane sulfonic acid results in decreased expression of KYNU mRNA CTD PMID:19162173 KYNU Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:737184 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KYNU mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 KYNU Human perfluorooctanoic acid decreases expression ISO RGD:71061 6480464 perfluorooctanoic acid results in decreased expression of KYNU mRNA CTD PMID:19162173 KYNU Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of KYNU mRNA CTD PMID:23978341 KYNU Human permethrin multiple interactions ISO RGD:71061 6480464 [Permethrin co-treated with DEET] results in increased methylation of KYNU gene CTD PMID:33148267 KYNU Human phenobarbital decreases expression ISO RGD:737184 6480464 Phenobarbital results in decreased expression of KYNU mRNA; Phenobarbital results in decreased expression of KYNU more ... CTD PMID:19482888|PMID:35881160 KYNU Human phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of KYNU protein CTD PMID:35881160 KYNU Human phenobarbital multiple interactions ISO RGD:737184 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of KYNU mRNA] CTD PMID:19482888 KYNU Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of KYNU mRNA CTD PMID:26272509 KYNU Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 KYNU Human PhIP increases expression ISO RGD:71061 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of KYNU mRNA CTD PMID:33945839 KYNU Human pirinixic acid multiple interactions ISO RGD:737184 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 KYNU Human pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:71061 6480464 Pregnenolone Carbonitrile results in decreased expression of KYNU mRNA CTD PMID:19162173 KYNU Human progesterone multiple interactions EXP 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of KYNU mRNA CTD PMID:20660070 KYNU Human resveratrol multiple interactions ISO RGD:71061 6480464 [resveratrol co-treated with Streptozocin] results in decreased expression of KYNU mRNA CTD PMID:25905778 KYNU Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of KYNU mRNA CTD PMID:23557933 KYNU Human rotenone decreases expression ISO RGD:71061 6480464 Rotenone results in decreased expression of KYNU mRNA CTD PMID:28374803|PMID:36553663 KYNU Human rotenone multiple interactions ISO RGD:71061 6480464 [Folic Acid co-treated with Vitamin B 12] inhibits the reaction [Rotenone results in decreased expression more ... CTD PMID:36553663 KYNU Human rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of KYNU mRNA CTD PMID:29955902 KYNU Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KYNU mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 KYNU Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 KYNU Human serpentine asbestos increases expression EXP 6480464 Asbestos, Serpentine results in increased expression of KYNU mRNA CTD PMID:24160326 KYNU Human silicon dioxide affects secretion EXP 6480464 Silicon Dioxide analog affects the secretion of KYNU protein CTD PMID:25895662 KYNU Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of KYNU mRNA CTD PMID:22300531|PMID:25351596 KYNU Human silver atom increases expression EXP 6480464 Silver results in increased expression of KYNU mRNA CTD PMID:26014281 KYNU Human silver(0) increases expression EXP 6480464 Silver results in increased expression of KYNU mRNA CTD PMID:26014281 KYNU Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of KYNU mRNA CTD PMID:22714537|PMID:28595984|PMID:34032870 KYNU Human sodium arsenite decreases expression ISO RGD:737184 6480464 sodium arsenite results in decreased expression of KYNU mRNA CTD PMID:37682722 KYNU Human sodium dichromate decreases expression ISO RGD:71061 6480464 sodium bichromate results in decreased expression of KYNU mRNA CTD PMID:25993096 KYNU Human streptozocin multiple interactions ISO RGD:71061 6480464 [resveratrol co-treated with Streptozocin] results in decreased expression of KYNU mRNA CTD PMID:25905778 KYNU Human sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of KYNU mRNA CTD PMID:26833863 KYNU Human tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of KYNU mRNA CTD PMID:15604281 KYNU Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of KYNU mRNA CTD PMID:31758290 KYNU Human tetrachloromethane affects expression ISO RGD:71061 6480464 Carbon Tetrachloride affects the expression of KYNU mRNA CTD PMID:12734012 KYNU Human tetrachloromethane decreases expression ISO RGD:71061 6480464 Carbon Tetrachloride results in decreased expression of KYNU mRNA CTD PMID:31150632 KYNU Human tetrachloromethane multiple interactions ISO RGD:71061 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of KYNU mRNA] CTD PMID:31150632 KYNU Human tetrachloromethane decreases expression ISO RGD:737184 6480464 Carbon Tetrachloride results in decreased expression of KYNU mRNA CTD PMID:27339419|PMID:31919559 KYNU Human thioacetamide decreases expression ISO RGD:71061 6480464 Thioacetamide results in decreased expression of KYNU mRNA CTD PMID:23411599|PMID:34492290 KYNU Human thioacetamide multiple interactions ISO RGD:71061 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of KYNU mRNA CTD PMID:28943392 KYNU Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of KYNU mRNA CTD PMID:38568856 KYNU Human triphenyl phosphate decreases expression ISO RGD:71061 6480464 triphenyl phosphate results in decreased expression of KYNU mRNA CTD PMID:30589522 KYNU Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of KYNU mRNA CTD PMID:37042841 KYNU Human troglitazone decreases expression ISO RGD:737184 6480464 troglitazone results in decreased expression of KYNU mRNA CTD PMID:28973697 KYNU Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of KYNU mRNA CTD PMID:28818685 KYNU Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of KYNU gene CTD PMID:29154799 KYNU Human valproic acid increases expression ISO RGD:71061 6480464 Valproic Acid results in increased expression of KYNU mRNA CTD PMID:35594946 KYNU Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 KYNU Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of KYNU mRNA CTD PMID:24383497|PMID:26272509|PMID:28001369 KYNU Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of KYNU mRNA CTD PMID:23179753 KYNU Human valproic acid affects expression ISO RGD:737184 6480464 Valproic Acid affects the expression of KYNU mRNA CTD PMID:17292431|PMID:17963808 KYNU Human vancomycin increases expression ISO RGD:737184 6480464 Vancomycin results in increased expression of KYNU mRNA CTD PMID:18930951 KYNU Human vinclozolin affects expression ISO RGD:71061 6480464 vinclozolin affects the expression of KYNU mRNA CTD PMID:23034163 KYNU Human vincristine increases expression EXP 6480464 Vincristine results in increased expression of KYNU mRNA CTD PMID:23649840 KYNU Human zidovudine multiple interactions EXP 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of KYNU mRNA CTD PMID:15784690 KYNU Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of KYNU mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (-)-demecolcine (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-benzylpiperazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (ISO) actinomycin D (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) antirheumatic drug (EXP) aristolochic acid A (EXP) arsenous acid (EXP) atazanavir sulfate (EXP) azathioprine (EXP) benzo[a]pyrene (EXP) beta-naphthoflavone (EXP,ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bromuconazole (ISO) buta-1,3-diene (ISO) cadmium atom (EXP) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) chenodeoxycholic acid (EXP) chloropicrin (EXP) chromium(6+) (EXP) cisplatin (EXP) clomiphene (EXP) cobalt dichloride (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (EXP) copper(II) sulfate (EXP) coumarin (ISO) crocidolite asbestos (EXP,ISO) curcumin (EXP) cyanocob(III)alamin (ISO) cyclosporin A (EXP,ISO) cypermethrin (ISO) cytarabine (EXP) D-glucose (ISO) DDE (EXP) deoxycholic acid (EXP) diarsenic trioxide (EXP) Dibutyl phosphate (EXP) dicrotophos (EXP) diethylstilbestrol (EXP) diquat (EXP,ISO) dorsomorphin (EXP) endosulfan (ISO) epoxiconazole (ISO) estrone (EXP) etoposide (EXP) fenvalerate (ISO) flavonoids (ISO) flutamide (ISO) folic acid (ISO) fructose (ISO) fulvestrant (EXP) furan (ISO) gamma-linolenic acid (EXP) genistein (EXP) glafenine (ISO) glucose (ISO) glycidyl methacrylate (EXP) glycochenodeoxycholic acid (EXP) glycocholic acid (EXP) glycodeoxycholic acid (EXP) gold atom (EXP) gold(0) (EXP) GW 4064 (ISO) hexestrol (EXP) hydrogen peroxide (EXP) indometacin (ISO) ivermectin (EXP) kynurenine (EXP) lamivudine (EXP) lipopolysaccharide (EXP) menadione (EXP) mercury dichloride (ISO) mestranol (EXP) methamphetamine (ISO) methapyrilene (ISO) methomyl (ISO) methylmercury chloride (EXP) N,N-diethyl-m-toluamide (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) nefazodone (EXP,ISO) nickel atom (EXP) nickel dichloride (EXP) nickel sulfate (EXP) nimesulide (ISO) nitroglycerin (ISO) Nutlin-3 (EXP) okadaic acid (EXP) ozone (ISO) p-toluidine (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenobarbital (EXP,ISO) phenylmercury acetate (EXP) PhIP (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) resveratrol (EXP,ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (EXP) SB 431542 (EXP) serpentine asbestos (EXP) silicon dioxide (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenite (EXP,ISO) sodium dichromate (ISO) streptozocin (ISO) sulforaphane (EXP) tamoxifen (EXP) temozolomide (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) triphenyl phosphate (EXP,ISO) troglitazone (ISO) urethane (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (ISO) vincristine (EXP) zidovudine (EXP) zoledronic acid (EXP)
1.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
2.
The kynurenine pathway and neurodegenerative disease.
Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
3.
Kynureninase is a novel candidate gene for hypertension in spontaneously hypertensive rats.
Mizutan K, etal., Hypertens Res 2002 Jan;25(1):135-40.
4.
Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.
Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
RGD HPO Phenotype Annotation Pipeline
RGD automated import pipeline for human HPO-to-gene-to-disease annotations
11.
The metabolism of L-tryptophan by isolated rat liver cells. Quantification of the relative importance of, and the effect of nutritional status on, the individual pathways of tryptophan metabolism.
Smith SA, etal., Biochem J. 1980 Nov 15;192(2):673-86.
12.
Kynurenine metabolism in vitamin-B-6-deficient rat liver after tryptophan injection.
Takeuchi F and Shibata Y, Biochem J. 1984 Jun 15;220(3):693-9.
13.
Cloning and recombinant expression of rat and human kynureninase.
Toma S, etal., FEBS Lett 1997 May 12;408(1):5-10.
KYNU Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 142,877,664 - 143,055,833 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 142,877,657 - 143,055,833 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 143,635,233 - 143,813,402 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 143,351,665 - 143,516,355 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 143,468,950 - 143,633,606 NCBI Celera 2 137,347,656 - 137,512,293 (+) NCBI Celera Cytogenetic Map 2 q22.2 NCBI HuRef 2 135,626,307 - 135,791,074 (+) NCBI HuRef CHM1_1 2 143,640,202 - 143,804,900 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 143,325,958 - 143,504,091 (+) NCBI T2T-CHM13v2.0
Kynu Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 43,445,270 - 43,572,734 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 43,445,341 - 43,572,734 (+) Ensembl GRCm39 Ensembl GRCm38 2 43,555,258 - 43,683,048 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 43,555,329 - 43,682,715 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 43,410,849 - 43,538,235 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 43,377,338 - 43,504,724 (+) NCBI MGSCv36 mm8 Celera 2 45,275,609 - 45,403,071 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 25.64 NCBI
Kynu Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 48,188,286 - 48,338,996 (+) NCBI GRCr8 mRatBN7.2 3 27,778,646 - 27,929,470 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 27,778,772 - 27,929,488 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 31,169,534 - 31,320,227 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 39,754,563 - 39,905,257 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 37,572,172 - 37,723,939 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 28,416,926 - 28,566,939 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 28,416,954 - 28,566,928 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 33,622,141 - 33,770,793 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 24,046,242 - 24,195,898 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 23,942,613 - 24,092,267 (+) NCBI Celera 3 26,096,675 - 26,244,576 (+) NCBI Celera Cytogenetic Map 3 q12 NCBI
Kynu Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955440 9,420,009 - 9,536,761 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955440 9,420,141 - 9,536,767 (+) NCBI ChiLan1.0 ChiLan1.0
KYNU Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 31,861,346 - 32,151,868 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 31,876,156 - 32,166,772 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 16,792,401 - 16,947,766 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 146,976,053 - 147,131,298 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 146,975,995 - 147,132,634 (+) Ensembl panpan1.1 panPan2
KYNU Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 45,022,450 - 45,150,977 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 45,022,072 - 45,149,339 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 45,274,902 - 45,404,061 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 46,479,473 - 46,607,767 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 46,479,626 - 46,607,752 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 45,139,690 - 45,268,624 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 45,269,758 - 45,399,409 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 46,664,690 - 46,794,435 (+) NCBI UU_Cfam_GSD_1.0
Kynu Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 107,812,529 - 107,984,835 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 33,632,892 - 33,734,433 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 33,632,885 - 33,805,158 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KYNU Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 8,850,544 - 8,982,891 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 8,847,335 - 8,982,951 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 9,760,379 - 9,821,853 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KYNU Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 28,230,129 - 28,394,103 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 28,230,508 - 28,394,076 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 171,182,800 - 171,346,370 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kynu
.
NM_003937.2(KYNU):c.373+4412G>T single nucleotide variant
Lung cancer [RCV000091497 ]
Chr2:142932153 [GRCh38]
uncertain significance
GRCh38/hg38 2q22.1-22.3(chr2:140186521-146528244)x1 copy number loss
See cases [RCV000051018 ]
Chr2:140186521..146528244 [GRCh38]
pathogenic
GRCh38/hg38 2q22.2-22.3(chr2:141666537-147845662)x1 copy number loss
See cases [RCV000054086 ]
Chr2:141666537..147845662 [GRCh38]
pathogenic
NM_003937.2(KYNU):c.169+1G>A single nucleotide variant
Malignant melanoma [RCV000060344 ]
Chr2:142885537 [GRCh38]
not provided
NM_003937.3(KYNU):c.592A>G (p.Thr198Ala) single nucleotide variant
Hydroxykynureninuria [RCV000148021 ]
Chr2:142960633 [GRCh38]
pathogenic|likely pathogenic|not provided
NM_003937.3(KYNU):c.563G>A (p.Arg188Gln) single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003387772 ]|not provided [RCV000148022 ]
Chr2:142957696 [GRCh38]
uncertain significance|not provided
GRCh38/hg38 2q22.1-22.3(chr2:136937358-146681810)x1 copy number loss
See cases [RCV000137506 ]
Chr2:136937358..146681810 [GRCh38]
pathogenic
GRCh38/hg38 2q22.1-22.2(chr2:140659197-142948096)x3 copy number gain
See cases [RCV000137664 ]
Chr2:140659197..142948096 [GRCh38]
uncertain significance
GRCh38/hg38 2q22.2(chr2:142197989-143208649)x3 copy number gain
See cases [RCV000143645 ]
Chr2:142197989..143208649 [GRCh38]
likely benign|uncertain significance
GRCh37/hg19 2q22.1-22.3(chr2:138578298-144874187)x1 copy number loss
See cases [RCV000449099 ]
Chr2:138578298..144874187 [GRCh37]
likely pathogenic
Single allele duplication
MBD5 associated neurodevelopmental disorder [RCV000454618 ]
Chr2:140621941..149324662 [GRCh37]
pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384) copy number gain
See cases [RCV000512056 ]
Chr2:12771..242783384 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.468T>A (p.Tyr156Ter) single nucleotide variant
Congenital NAD deficiency disorder [RCV000496184 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV000505808 ]|not provided [RCV000522905 ]
Chr2:142956235 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.1045_1051del (p.Phe349fs) deletion
Congenital NAD deficiency disorder [RCV000496114 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV000505812 ]|not provided [RCV000520521 ]
Chr2:143040430..143040436 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.170-1G>T single nucleotide variant
Congenital NAD deficiency disorder [RCV000496147 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV000505804 ]
Chr2:142918608 [GRCh38]
pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384)x3 copy number gain
See cases [RCV000511212 ]
Chr2:12771..242783384 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.1073G>A (p.Arg358Gln) single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV005249495 ]|not specified [RCV004330898 ]
Chr2:143040459 [GRCh38]
uncertain significance
GRCh37/hg19 2q12.1-24.3(chr2:104172062-168223828)x1 copy number loss
Poly (ADP-Ribose) polymerase inhibitor response [RCV000626436 ]
Chr2:104172062..168223828 [GRCh37]
drug response
Single allele deletion
not provided [RCV000714264 ]
Chr2:40608411..146900718 [GRCh37]
likely pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:14238-243048760)x3 copy number gain
not provided [RCV000752802 ]
Chr2:14238..243048760 [GRCh37]
pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:15672-243101834)x3 copy number gain
not provided [RCV000752804 ]
Chr2:15672..243101834 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.759T>C (p.His253=) single nucleotide variant
not provided [RCV000894540 ]
Chr2:142985113 [GRCh38]
benign
NM_003937.3(KYNU):c.303T>C (p.Gly101=) single nucleotide variant
not provided [RCV000894981 ]
Chr2:142927671 [GRCh38]
likely benign
NM_003937.3(KYNU):c.585G>A (p.Gly195=) single nucleotide variant
not provided [RCV000883675 ]
Chr2:142960626 [GRCh38]
benign
NM_003937.3(KYNU):c.732T>C (p.Gly244=) single nucleotide variant
not provided [RCV000915143 ]
Chr2:142985086 [GRCh38]
likely benign
NM_003937.3(KYNU):c.291-7A>G single nucleotide variant
not provided [RCV000904248 ]|not specified [RCV003479242 ]
Chr2:142927652 [GRCh38]
likely benign|uncertain significance
NM_003937.3(KYNU):c.74C>T (p.Thr25Met) single nucleotide variant
not provided [RCV000972582 ]
Chr2:142885441 [GRCh38]
benign
NM_003937.3(KYNU):c.123C>T (p.His41=) single nucleotide variant
not provided [RCV000966826 ]
Chr2:142885490 [GRCh38]
benign
NM_003937.3(KYNU):c.729+9G>A single nucleotide variant
not provided [RCV000883088 ]
Chr2:142960779 [GRCh38]
benign
NM_003937.3(KYNU):c.828+9G>A single nucleotide variant
not provided [RCV000974004 ]
Chr2:142985191 [GRCh38]
likely benign
NM_003937.3(KYNU):c.195T>C (p.Asp65=) single nucleotide variant
not provided [RCV000936487 ]
Chr2:142918634 [GRCh38]
likely benign
NM_003937.3(KYNU):c.828+8C>T single nucleotide variant
not provided [RCV000943103 ]
Chr2:142985190 [GRCh38]
likely benign
NM_003937.3(KYNU):c.60C>T (p.Leu20=) single nucleotide variant
KYNU-related disorder [RCV004553522 ]|not provided [RCV000982675 ]
Chr2:142885427 [GRCh38]
likely benign
NM_003937.3(KYNU):c.1260A>G (p.Lys420=) single nucleotide variant
not provided [RCV000982501 ]
Chr2:143040646 [GRCh38]
likely benign
GRCh37/hg19 2q22.2-22.3(chr2:143192287-144325954)x3 copy number gain
not provided [RCV000849947 ]
Chr2:143192287..144325954 [GRCh37]
uncertain significance
GRCh37/hg19 2q22.2(chr2:143290896-143804910)x3 copy number gain
not provided [RCV000847135 ]
Chr2:143290896..143804910 [GRCh37]
uncertain significance
NM_003937.3(KYNU):c.26C>T (p.Pro9Leu) single nucleotide variant
not specified [RCV004289504 ]
Chr2:142885393 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.121C>T (p.His41Tyr) single nucleotide variant
not provided [RCV000901517 ]
Chr2:142885488 [GRCh38]
likely benign
NM_003937.3(KYNU):c.1047T>C (p.Phe349=) single nucleotide variant
KYNU-related disorder [RCV004740491 ]|not provided [RCV000889456 ]
Chr2:143040433 [GRCh38]
benign|likely benign
GRCh37/hg19 2q22.2(chr2:142738538-143643346)x3 copy number gain
not provided [RCV001005325 ]
Chr2:142738538..143643346 [GRCh37]
uncertain significance
Single allele deletion
Mowat-Wilson syndrome [RCV001250753 ]
Chr2:137639637..146827604 [GRCh37]
pathogenic
NC_000002.12:g.142877008_142961693del deletion
Catel-Manzke syndrome [RCV001256672 ]
Chr2:142877008..142961693 [GRCh38]
pathogenic
GRCh37/hg19 2q21.3-23.3(chr2:136473383-152727396) copy number gain
Global developmental delay [RCV001352659 ]
Chr2:136473383..152727396 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.788A>G (p.His263Arg) single nucleotide variant
Congenital NAD deficiency disorder [RCV001391062 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003883466 ]
Chr2:142985142 [GRCh38]
pathogenic
NM_003937.3(KYNU):c.616G>A (p.Glu206Lys) single nucleotide variant
Congenital NAD deficiency disorder [RCV001391063 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003883467 ]
Chr2:142960657 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.361_363del (p.Lys121del) deletion
Congenital NAD deficiency disorder [RCV001391064 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003883468 ]
Chr2:142927728..142927730 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.1035T>A (p.Ser345Arg) single nucleotide variant
Congenital NAD deficiency disorder [RCV001391065 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003883469 ]
Chr2:143033315 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.489del (p.Ala164fs) deletion
Congenital NAD deficiency disorder [RCV001391066 ]|not provided [RCV004727068 ]
Chr2:142956254 [GRCh38]
pathogenic
NM_003937.3(KYNU):c.955+26C>T single nucleotide variant
Hydroxykynureninuria [RCV001731086 ]|Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV001731087 ]|not provided [RCV004709134 ]
Chr2:143029705 [GRCh38]
benign
NM_003937.3(KYNU):c.256dup (p.Tyr86fs) duplication
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003326157 ]|not provided [RCV001782359 ]
Chr2:142918694..142918695 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.902+1G>A single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV001808860 ]
Chr2:142986022 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.455C>T (p.Thr152Met) single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV001808094 ]|not specified [RCV004040928 ]
Chr2:142956222 [GRCh38]
uncertain significance
GRCh37/hg19 2q22.2-23.3(chr2:142409401-152680804)x3 copy number gain
not provided [RCV001834428 ]
Chr2:142409401..152680804 [GRCh37]
pathogenic
GRCh37/hg19 2q14.3-22.2(chr2:122699106-143799629)x1 copy number loss
not provided [RCV001832883 ]
Chr2:122699106..143799629 [GRCh37]
pathogenic
GRCh37/hg19 2q22.2-23.3(chr2:143258712-152867819) copy number loss
not specified [RCV002053238 ]
Chr2:143258712..152867819 [GRCh37]
pathogenic
GRCh37/hg19 2q22.2(chr2:143440277-143686832) copy number gain
not specified [RCV002053239 ]
Chr2:143440277..143686832 [GRCh37]
uncertain significance
GRCh37/hg19 2q13-22.3(chr2:111484468-146333604)x3 copy number gain
not provided [RCV001832896 ]
Chr2:111484468..146333604 [GRCh37]
pathogenic
GRCh37/hg19 2q22.1-22.3(chr2:138578298-144874187) copy number loss
not specified [RCV002053235 ]
Chr2:138578298..144874187 [GRCh37]
likely pathogenic
GRCh37/hg19 2q13-22.3(chr2:112475655-145691999)x3 copy number gain
2q13q22.3 microduplication syndrome [RCV002226436 ]
Chr2:112475655..145691999 [GRCh37]
pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:1-243199373) copy number gain
Mosaic trisomy 2 [RCV002280628 ]
Chr2:1..243199373 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.890C>T (p.Thr297Met) single nucleotide variant
not provided [RCV004776696 ]
Chr2:142986009 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.773T>C (p.Val258Ala) single nucleotide variant
Hydroxykynureninuria [RCV002249093 ]
Chr2:142985127 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.374-2A>G single nucleotide variant
not provided [RCV002275699 ]
Chr2:142954808 [GRCh38]
not provided
NM_003937.3(KYNU):c.374-433_435+369del deletion
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV002265065 ]
Chr2:142954376..142955239 [GRCh38]
pathogenic
NM_003937.3(KYNU):c.199A>G (p.Asn67Asp) single nucleotide variant
not specified [RCV004307616 ]
Chr2:142918638 [GRCh38]
uncertain significance
GRCh37/hg19 2q22.2(chr2:143610406-143881574)x3 copy number gain
not provided [RCV002474638 ]
Chr2:143610406..143881574 [GRCh37]
uncertain significance
NM_003937.3(KYNU):c.903-2A>C single nucleotide variant
not provided [RCV002614948 ]
Chr2:143029625 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.574C>G (p.Pro192Ala) single nucleotide variant
not specified [RCV004201495 ]
Chr2:142957707 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.967del (p.Ile323fs) deletion
not provided [RCV002640483 ]
Chr2:143033246 [GRCh38]
pathogenic
NM_003937.3(KYNU):c.601A>G (p.Ile201Val) single nucleotide variant
not specified [RCV004145850 ]
Chr2:142960642 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.127A>G (p.Arg43Gly) single nucleotide variant
not specified [RCV004134099 ]
Chr2:142885494 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.562C>T (p.Arg188Trp) single nucleotide variant
not specified [RCV004186803 ]
Chr2:142957695 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.142A>T (p.Ile48Phe) single nucleotide variant
not specified [RCV004124440 ]
Chr2:142885509 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.656T>C (p.Leu219Pro) single nucleotide variant
not provided [RCV004778051 ]
Chr2:142960697 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.845C>T (p.Ala282Val) single nucleotide variant
not specified [RCV004270364 ]
Chr2:142985964 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.85G>A (p.Val29Met) single nucleotide variant
not specified [RCV004273063 ]
Chr2:142885452 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1168A>G (p.Ile390Val) single nucleotide variant
not specified [RCV004306687 ]
Chr2:143040554 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.865T>C (p.Phe289Leu) single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003326203 ]
Chr2:142985984 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.510T>A (p.Tyr170Ter) single nucleotide variant
KYNU-related disorder [RCV003335880 ]
Chr2:142957643 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.825C>A (p.Tyr275Ter) single nucleotide variant
KYNU-related disorder [RCV003335881 ]
Chr2:142985179 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.518A>G (p.Glu173Gly) single nucleotide variant
not specified [RCV004335772 ]
Chr2:142957651 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.735T>G (p.Cys245Trp) single nucleotide variant
not specified [RCV003479743 ]
Chr2:142985089 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.373_373+3del deletion
KYNU-related disorder [RCV004550769 ]
Chr2:142927738..142927741 [GRCh38]
likely pathogenic
NM_003937.3:c.788A>G single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003882757 ]
pathogenic
NM_003937.3:c.361_363del deletion
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003882759 ]
pathogenic
NM_003937.3:c.1035T>A variation
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003882760 ]
pathogenic
NM_003937.3(KYNU):c.1041G>A (p.Glu347=) single nucleotide variant
not provided [RCV003487982 ]
Chr2:143033321 [GRCh38]
uncertain significance
NM_003937.3:c.616G>A single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003882758 ]
pathogenic
GRCh37/hg19 2q22.2(chr2:143627015-143881574)x3 copy number gain
not specified [RCV003986143 ]
Chr2:143627015..143881574 [GRCh37]
uncertain significance
GRCh37/hg19 2q21.2-23.2(chr2:134589311-149951291)x3 copy number gain
not specified [RCV003986337 ]
Chr2:134589311..149951291 [GRCh37]
likely pathogenic
NM_003937.3(KYNU):c.1303G>A (p.Val435Met) single nucleotide variant
Vertebral, cardiac, renal, and limb defects syndrome 2 [RCV003990255 ]
Chr2:143042077 [GRCh38]
uncertain significance
GRCh37/hg19 2q22.2-22.3(chr2:142681355-146293674)x1 copy number loss
not provided [RCV003885493 ]
Chr2:142681355..146293674 [GRCh37]
pathogenic
NM_003937.3(KYNU):c.1178C>T (p.Pro393Leu) single nucleotide variant
not specified [RCV004407038 ]
Chr2:143040564 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1207C>A (p.Leu403Ile) single nucleotide variant
not specified [RCV004407039 ]
Chr2:143040593 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1232A>G (p.Asn411Ser) single nucleotide variant
not specified [RCV004407040 ]
Chr2:143040618 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.170T>C (p.Val57Ala) single nucleotide variant
not specified [RCV004407042 ]
Chr2:142918609 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.44G>A (p.Arg15His) single nucleotide variant
not specified [RCV004407043 ]
Chr2:142885411 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.650T>C (p.Val217Ala) single nucleotide variant
not provided [RCV004780709 ]|not specified [RCV004407044 ]
Chr2:142960691 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.725C>T (p.Ala242Val) single nucleotide variant
not specified [RCV004407045 ]
Chr2:142960766 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.731G>T (p.Gly244Val) single nucleotide variant
not specified [RCV004407046 ]
Chr2:142985085 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.764T>C (p.Val255Ala) single nucleotide variant
not specified [RCV004407047 ]
Chr2:142985118 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.946A>G (p.Met316Val) single nucleotide variant
not specified [RCV004407048 ]
Chr2:143029670 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.136T>C (p.Phe46Leu) single nucleotide variant
not specified [RCV004639802 ]
Chr2:142885503 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.580G>A (p.Glu194Lys) single nucleotide variant
not specified [RCV004639800 ]
Chr2:142957713 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1335T>G (p.His445Gln) single nucleotide variant
not specified [RCV004639799 ]
Chr2:143042109 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.818G>A (p.Cys273Tyr) single nucleotide variant
not specified [RCV004639801 ]
Chr2:142985172 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.548T>C (p.Ile183Thr) single nucleotide variant
not specified [RCV004639797 ]
Chr2:142957681 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1072C>T (p.Arg358Trp) single nucleotide variant
not specified [RCV004639798 ]
Chr2:143040458 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.967A>C (p.Ile323Leu) single nucleotide variant
not specified [RCV004938031 ]
Chr2:143033247 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.793T>A (p.Trp265Arg) single nucleotide variant
not specified [RCV004938034 ]
Chr2:142985147 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.560T>G (p.Met187Arg) single nucleotide variant
not specified [RCV004938035 ]
Chr2:142957693 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.737dup (p.Tyr246Ter) duplication
KYNU-related disorder [RCV004740949 ]
Chr2:142985090..142985091 [GRCh38]
likely pathogenic
NM_003937.3(KYNU):c.-7A>T single nucleotide variant
KYNU-related disorder [RCV004739929 ]
Chr2:142885361 [GRCh38]
likely benign
NM_003937.3(KYNU):c.299A>G (p.Tyr100Cys) single nucleotide variant
not specified [RCV004938030 ]
Chr2:142927667 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1228C>T (p.Pro410Ser) single nucleotide variant
not specified [RCV004938032 ]
Chr2:143040614 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.853A>G (p.Ile285Val) single nucleotide variant
not specified [RCV004938033 ]
Chr2:142985972 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1273T>C (p.Cys425Arg) single nucleotide variant
Hydroxykynureninuria [RCV005028813 ]
Chr2:143042047 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.643A>T (p.Ile215Phe) single nucleotide variant
Hydroxykynureninuria [RCV005028812 ]
Chr2:142960684 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.758A>G (p.His253Arg) single nucleotide variant
not specified [RCV004296767 ]
Chr2:142985112 [GRCh38]
uncertain significance
NM_003937.3(KYNU):c.1282C>T (p.Arg428Trp) single nucleotide variant
Catel-Manzke syndrome [RCV001256673 ]|Congenital NAD deficiency disorder [RCV001391067 ]|not provided [RCV003313200 ]
Chr2:143042056 [GRCh38]
pathogenic|likely pathogenic
NM_003937.3(KYNU):c.989G>A (p.Arg330Gln) single nucleotide variant
Catel-Manzke syndrome [RCV001256674 ]
Chr2:143033269 [GRCh38]
pathogenic
NM_003937.3(KYNU):c.326G>C (p.Trp109Ser) single nucleotide variant
Catel-Manzke syndrome [RCV001256675 ]
Chr2:142927694 [GRCh38]
pathogenic
Predicted Target Of
Count of predictions: 416 Count of miRNA genes: 318 Interacting mature miRNAs: 341 Transcripts: ENST00000264170, ENST00000375773, ENST00000409512, ENST00000410015, ENST00000424385, ENST00000460143 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597187033 GWAS1283107_H X-15503 measurement QTL GWAS1283107 (human) 2e-19 X-15503 measurement 2 143020781 143020782 Human 597341400 GWAS1437474_H asthma QTL GWAS1437474 (human) 1e-08 asthma 2 143030652 143030653 Human 597281690 GWAS1377764_H X-15503 measurement QTL GWAS1377764 (human) 7e-12 X-15503 measurement 2 142991224 142991225 Human 597280029 GWAS1376103_H N-formylanthranilic acid measurement QTL GWAS1376103 (human) 5e-16 N-formylanthranilic acid measurement 2 143030653 143030654 Human 597238237 GWAS1334311_H neutrophil-to-lymphocyte ratio QTL GWAS1334311 (human) 3e-12 neutrophil quantity (VT:0000222) 2 143044106 143044107 Human 597120338 GWAS1216412_H blood protein measurement QTL GWAS1216412 (human) 1e-145 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 2 143036245 143036246 Human 597302557 GWAS1398631_H platelet count QTL GWAS1398631 (human) 9e-13 platelet quantity (VT:0003179) platelet count (CMO:0000029) 2 143032297 143032298 Human 597299997 GWAS1396071_H kynureninase measurement QTL GWAS1396071 (human) 2e-58 kynureninase measurement 2 143042338 143042339 Human 597219359 GWAS1315433_H platelet count QTL GWAS1315433 (human) 3e-08 platelet quantity (VT:0003179) platelet count (CMO:0000029) 2 143044106 143044107 Human 597163099 GWAS1259173_H serum metabolite measurement QTL GWAS1259173 (human) 0.000006 serum metabolite measurement 2 143001888 143001889 Human 597083418 GWAS1179492_H protein measurement QTL GWAS1179492 (human) 5e-41 protein measurement 2 143039125 143039126 Human 597431697 GWAS1527771_H protein measurement QTL GWAS1527771 (human) 2e-15 protein measurement 2 143043227 143043228 Human 597339982 GWAS1436056_H breast density QTL GWAS1436056 (human) 0.000003 breast density 2 143030220 143030221 Human 597113728 GWAS1209802_H platelet count QTL GWAS1209802 (human) 1e-11 platelet quantity (VT:0003179) platelet count (CMO:0000029) 2 143032297 143032298 Human 597239758 GWAS1335832_H lymphocyte count QTL GWAS1335832 (human) 1e-26 lymphocyte count blood lymphocyte count (CMO:0000031) 2 143044106 143044107 Human 597059852 GWAS1155926_H adolescent idiopathic scoliosis QTL GWAS1155926 (human) 0.000007 adolescent idiopathic scoliosis 2 142962382 142962383 Human 597319558 GWAS1415632_H xanthurenate measurement QTL GWAS1415632 (human) 9e-24 xanthurenate measurement 2 143033224 143033225 Human 597618305 GWAS1675165_H Hematemesis QTL GWAS1675165 (human) 2e-11 Hematemesis 2 143037422 143037423 Human 597317688 GWAS1413762_H X-15503 measurement QTL GWAS1413762 (human) 1e-40 X-15503 measurement 2 143043175 143043176 Human 597027697 GWAS1123771_H blood protein measurement QTL GWAS1123771 (human) 7e-83 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 2 143039125 143039126 Human 407252512 GWAS901488_H asthma QTL GWAS901488 (human) 2e-08 asthma 2 143019929 143019930 Human 597312434 GWAS1408508_H X-15503 measurement QTL GWAS1408508 (human) 1e-19 X-15503 measurement 2 143017266 143017267 Human 597274097 GWAS1370171_H kynureninase measurement QTL GWAS1370171 (human) 8e-102 kynureninase measurement 2 143043759 143043760 Human 597292080 GWAS1388154_H kynureninase measurement QTL GWAS1388154 (human) 1e-81 kynureninase measurement 2 143040620 143040621 Human 597312432 GWAS1408506_H X-15503 measurement QTL GWAS1408506 (human) 1e-13 X-15503 measurement 2 143017266 143017267 Human 597274098 GWAS1370172_H kynureninase measurement QTL GWAS1370172 (human) 4e-26 kynureninase measurement 2 143038112 143038113 Human 597184873 GWAS1280947_H N-formylanthranilic acid measurement QTL GWAS1280947 (human) 6e-17 N-formylanthranilic acid measurement 2 143041434 143041435 Human 597266603 GWAS1362677_H kynureninase measurement QTL GWAS1362677 (human) 2e-112 kynureninase measurement 2 143046278 143046279 Human 597041313 GWAS1137387_H soluble triggering receptor expressed on myeloid cells 2 measurement QTL GWAS1137387 (human) 0.0000004 soluble triggering receptor expressed on myeloid cells 2 measurement 2 142878150 142878151 Human 406962170 GWAS611146_H selenium measurement QTL GWAS611146 (human) 0.000004 selenium measurement 2 143002122 143002123 Human 597278498 GWAS1374572_H xanthurenate measurement QTL GWAS1374572 (human) 5e-18 xanthurenate measurement 2 143042078 143042079 Human 597244194 GWAS1340268_H blood protein measurement QTL GWAS1340268 (human) 6e-11 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 2 143044106 143044107 Human 597313958 GWAS1410032_H total blood protein measurement QTL GWAS1410032 (human) 5e-10 total blood protein measurement blood protein measurement (CMO:0000028) 2 143032297 143032298 Human 597175589 GWAS1271663_H kynureninase measurement QTL GWAS1271663 (human) 3e-23 kynureninase measurement 2 142907166 142907167 Human 597112361 GWAS1208435_H blood protein measurement QTL GWAS1208435 (human) 7e-17 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 2 142917663 142917664 Human 597175590 GWAS1271664_H kynureninase measurement QTL GWAS1271664 (human) 1e-519 kynureninase measurement 2 143043636 143043637 Human
WI-11702
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 143,799,721 - 143,799,850 UniSTS GRCh37 Build 36 2 143,516,191 - 143,516,320 RGD NCBI36 Celera 2 137,512,129 - 137,512,258 RGD Cytogenetic Map 2 q22.2 UniSTS HuRef 2 135,790,910 - 135,791,039 UniSTS GeneMap99-GB4 RH Map 2 487.5 UniSTS Whitehead-RH Map 2 777.2 UniSTS NCBI RH Map 2 1043.4 UniSTS
SHGC-132405
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 143,717,189 - 143,717,461 UniSTS GRCh37 Build 36 2 143,433,659 - 143,433,931 RGD NCBI36 Celera 2 137,429,588 - 137,429,861 RGD Cytogenetic Map 2 q22.2 UniSTS HuRef 2 135,708,276 - 135,708,549 UniSTS TNG Radiation Hybrid Map 2 77206.0 UniSTS
A004C41
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 143,799,654 - 143,799,807 UniSTS GRCh37 Build 36 2 143,516,124 - 143,516,277 RGD NCBI36 Celera 2 137,512,062 - 137,512,215 RGD Cytogenetic Map 2 q22.2 UniSTS HuRef 2 135,790,843 - 135,790,996 UniSTS GeneMap99-GB4 RH Map 2 494.64 UniSTS
SHGC-33569
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 143,698,005 - 143,698,129 UniSTS GRCh37 Build 36 2 143,414,475 - 143,414,599 RGD NCBI36 Celera 2 137,410,403 - 137,410,527 RGD Cytogenetic Map 2 q22.2 UniSTS HuRef 2 135,689,088 - 135,689,212 UniSTS GeneMap99-GB4 RH Map 2 495.46 UniSTS Whitehead-RH Map 2 773.8 UniSTS GeneMap99-G3 RH Map 2 6706.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2436
2769
2245
4935
1725
2346
5
623
1948
465
2268
7265
6452
53
3697
1
849
1739
1613
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000264170 ⟹ ENSP00000264170
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,877,664 - 143,055,833 (+) Ensembl
Ensembl Acc Id:
ENST00000375773 ⟹ ENSP00000364928
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,877,657 - 142,990,052 (+) Ensembl
Ensembl Acc Id:
ENST00000409512 ⟹ ENSP00000386731
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,877,664 - 143,042,172 (+) Ensembl
Ensembl Acc Id:
ENST00000410015 ⟹ ENSP00000387296
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,877,666 - 142,947,421 (+) Ensembl
Ensembl Acc Id:
ENST00000424385 ⟹ ENSP00000401190
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,877,684 - 142,954,871 (+) Ensembl
Ensembl Acc Id:
ENST00000460143
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,918,679 - 142,958,075 (+) Ensembl
Ensembl Acc Id:
ENST00000612147 ⟹ ENSP00000481930
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,918,679 - 142,967,494 (+) Ensembl
Ensembl Acc Id:
ENST00000613664 ⟹ ENSP00000482009
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,927,659 - 142,971,393 (+) Ensembl
Ensembl Acc Id:
ENST00000621320 ⟹ ENSP00000484801
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 142,885,395 - 142,964,752 (+) Ensembl
RefSeq Acc Id:
NM_001032998 ⟹ NP_001028170
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,990,065 (+) NCBI GRCh37 2 143,506,497 - 143,799,885 (+) NCBI Build 36 2 143,351,665 - 143,463,576 (+) NCBI Archive HuRef 2 135,626,307 - 135,791,074 (+) ENTREZGENE CHM1_1 2 143,640,202 - 143,752,144 (+) NCBI T2T-CHM13v2.0 2 143,325,958 - 143,438,324 (+) NCBI
Sequence:
ACATTTTCAAGGAATTCTTGAGAGGTTCTTGGAGAGATTCTGGGAGCCAAACACTCCATTGGGATCCTAGCTGTTTTAGAGAACAACTTGTAATGGAGCCTTCATCTCTTGAGCTGCCGGCTGACACA
hide sequence
RefSeq Acc Id:
NM_001199241 ⟹ NP_001186170
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 143,055,833 (+) NCBI GRCh37 2 143,506,497 - 143,799,885 (+) NCBI HuRef 2 135,626,307 - 135,791,074 (+) ENTREZGENE CHM1_1 2 143,640,202 - 143,804,900 (+) NCBI T2T-CHM13v2.0 2 143,325,958 - 143,504,091 (+) NCBI
Sequence:
ACATTTTCAAGGAATTCTTGAGAGGTTCTTGGAGAGATTCTGGGAGCCAAACACTCCATTGGGATCCTAGCTGGAATATAAAGAATGGCTTATCAGTGGAGACCATCGACAGTTGAGAAAAGAAGAAG
hide sequence
RefSeq Acc Id:
NM_003937 ⟹ NP_003928
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 143,055,833 (+) NCBI GRCh37 2 143,506,497 - 143,799,885 (+) NCBI Build 36 2 143,351,665 - 143,516,355 (+) NCBI Archive HuRef 2 135,626,307 - 135,791,074 (+) ENTREZGENE CHM1_1 2 143,640,202 - 143,804,900 (+) NCBI T2T-CHM13v2.0 2 143,325,958 - 143,504,091 (+) NCBI
Sequence:
ACATTTTCAAGGAATTCTTGAGAGGTTCTTGGAGAGATTCTGGGAGCCAAACACTCCATTGGGA
hide sequence
RefSeq Acc Id:
XM_017005217 ⟹ XP_016860706
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,989,537 (+) NCBI
Sequence:
ACATTTTCAAGGAATTCTTGAGAGGTTCTTGGAGAGATTCTGGGAGCCAAACACTCCATTGGGATCCTAGCTGTTTTAGAGAACAACTTGTAATGGAGCCTTCATCTCTTGAGCTGCCGGCTGACACA
hide sequence
RefSeq Acc Id:
XM_047446250 ⟹ XP_047302206
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 143,037,265 (+) NCBI
RefSeq Acc Id:
XM_047446251 ⟹ XP_047302207
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,989,537 (+) NCBI
RefSeq Acc Id:
XM_047446252 ⟹ XP_047302208
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,989,537 (+) NCBI
RefSeq Acc Id:
XM_047446253 ⟹ XP_047302209
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,986,025 (+) NCBI
RefSeq Acc Id:
XM_054344414 ⟹ XP_054200389
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 2 143,325,958 - 143,485,541 (+) NCBI
RefSeq Acc Id:
XM_054344415 ⟹ XP_054200390
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 2 143,325,958 - 143,438,311 (+) NCBI
RefSeq Acc Id:
XM_054344416 ⟹ XP_054200391
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 2 143,325,958 - 143,438,311 (+) NCBI
RefSeq Acc Id:
XM_054344417 ⟹ XP_054200392
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 2 143,325,958 - 143,438,311 (+) NCBI
RefSeq Acc Id:
NP_001186170 ⟸ NM_001199241
- Peptide Label:
isoform a
- UniProtKB:
Q6I9T2 (UniProtKB/Swiss-Prot), D3DP79 (UniProtKB/Swiss-Prot), B2RCZ5 (UniProtKB/Swiss-Prot), Q9BVW3 (UniProtKB/Swiss-Prot), Q16719 (UniProtKB/Swiss-Prot), A8K4D5 (UniProtKB/TrEMBL)
- Sequence:
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANE
hide sequence
RefSeq Acc Id:
NP_003928 ⟸ NM_003937
- Peptide Label:
isoform a
- UniProtKB:
Q6I9T2 (UniProtKB/Swiss-Prot), D3DP79 (UniProtKB/Swiss-Prot), B2RCZ5 (UniProtKB/Swiss-Prot), Q9BVW3 (UniProtKB/Swiss-Prot), Q16719 (UniProtKB/Swiss-Prot), A8K4D5 (UniProtKB/TrEMBL)
- Sequence:
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANE
hide sequence
RefSeq Acc Id:
NP_001028170 ⟸ NM_001032998
- Peptide Label:
isoform b
- UniProtKB:
Q16719 (UniProtKB/Swiss-Prot)
- Sequence:
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANE
hide sequence
RefSeq Acc Id:
XP_016860706 ⟸ XM_017005217
- Peptide Label:
isoform X2
- UniProtKB:
Q16719 (UniProtKB/Swiss-Prot)
- Sequence:
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNK
hide sequence
Ensembl Acc Id:
ENSP00000387296 ⟸ ENST00000410015
Ensembl Acc Id:
ENSP00000401190 ⟸ ENST00000424385
Ensembl Acc Id:
ENSP00000484801 ⟸ ENST00000621320
Ensembl Acc Id:
ENSP00000364928 ⟸ ENST00000375773
Ensembl Acc Id:
ENSP00000481930 ⟸ ENST00000612147
Ensembl Acc Id:
ENSP00000482009 ⟸ ENST00000613664
Ensembl Acc Id:
ENSP00000386731 ⟸ ENST00000409512
Ensembl Acc Id:
ENSP00000264170 ⟸ ENST00000264170
RefSeq Acc Id:
XP_047302206 ⟸ XM_047446250
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_047302208 ⟸ XM_047446252
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_047302207 ⟸ XM_047446251
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_047302209 ⟸ XM_047446253
- Peptide Label:
isoform X3
- UniProtKB:
Q53SX6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054200389 ⟸ XM_054344414
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054200392 ⟸ XM_054344417
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054200391 ⟸ XM_054344416
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054200390 ⟸ XM_054344415
- Peptide Label:
isoform X2
RGD ID: 6861672 Promoter ID: EPDNEW_H4001 Type: initiation region Name: KYNU_1 Description: kynureninase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 2 142,877,664 - 142,877,724 EPDNEW
RGD ID: 6797204 Promoter ID: HG_KWN:35255 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: ENST00000392874, ENST00000410015, NM_001032998, OTTHUMT00000254772, OTTHUMT00000332173, UC010FNM.1 Position: Human Assembly Chr Position (strand) Source Build 36 2 143,351,021 - 143,351,722 (+) MPROMDB
RGD ID: 6852434 Promoter ID: EP74026 Type: initiation region Name: HS_KYNU Description: Kynureninase (L-kynurenine hydrolase). SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 2 143,351,703 - 143,351,763 EPD
RGD ID: 6797724 Promoter ID: HG_KWN:35256 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: OTTHUMT00000332174 Position: Human Assembly Chr Position (strand) Source Build 36 2 143,392,081 - 143,392,932 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-07-27
KYNU
kynureninase
KYNU
kynureninase (L-kynurenine hydrolase)
Symbol and/or name change
5135510 APPROVED
