Advanced Search (OLGA)

Gene: SLC25A11 (solute carrier family 25 member 11) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

SLC25A11

Name:

solute carrier family 25 member 11

RGD ID:

732504

HGNC Page

HGNC:10981

Description:

Enables RNA binding activity. Involved in malate-aspartate shuttle. Located in mitochondrion and nucleus. Implicated in paraganglioma.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-oxoglutarate carrier; alpha-oxoglutarate carrier; mitochondrial 2-oxoglutarate/malate carrier protein; OGC; OGCP; PGL6; PPGL6; SLC20A4; solute carrier family 20 (oxoglutarate carrier), member 4; solute carrier family 25 (mitochondrial carrier, oxoglutarate carrier), member 11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Slc25a11 (solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Slc25a11 (solute carrier family 25 member 11)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Slc25a11 (solute carrier family 25 member 11)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	SLC25A11 (solute carrier family 25 member 11)	NCBI	Ortholog
Canis lupus familiaris (dog):	SLC25A11 (solute carrier family 25 member 11)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc25a11 (solute carrier family 25 member 11)	NCBI	Ortholog
Sus scrofa (pig):	SLC25A11 (solute carrier family 25 member 11)	HGNC	EggNOG, Ensembl, NCBI, OrthoDB, Treefam
Chlorocebus sabaeus (green monkey):	SLC25A11 (solute carrier family 25 member 11)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Slc25a11 (solute carrier family 25 member 11)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Slc25a11 (solute carrier family 25 member 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc25a11 (solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc25a11 (solute carrier family 25 member 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CG18418	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	misc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1907	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7514	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus laevis (African clawed frog):	slc25a11.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	rangrf	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc25a11	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus laevis (African clawed frog):	slc25a11.S	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	4,937,130 - 4,940,046 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	4,937,130 - 4,940,053 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	4,840,425 - 4,843,341 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	4,781,349 - 4,784,063 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	4,781,348 - 4,784,063	NCBI
Celera	17	4,855,235 - 4,858,273 (-)	NCBI		Celera
Cytogenetic Map	17	p13.2	NCBI
HuRef	17	4,728,014 - 4,731,052 (-)	NCBI		HuRef
CHM1_1	17	4,849,762 - 4,852,800 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	4,827,477 - 4,830,394 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	congenital myasthenic syndrome 4A		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Congenital myasthenic syndrome 4A	ClinVar	PMID:28492532
SLC25A11	Human	Paragangliomas 6		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Paragangliomas 6	ClinVar	PMID:29431636
SLC25A11	Human	Paragangliomas 6		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: SLC25A11-related condition	ClinVar	PMID:28492532
SLC25A11	Human	spastic ataxia 2		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic ataxia 2	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	adult respiratory distress syndrome		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25070658

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	Paragangliomas 6		IAGP		7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	(+)-schisandrin B	multiple interactions	ISO	Slc25a11 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SLC25A11 mRNA]	CTD	PMID:31150632
SLC25A11	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	Slc25a11 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC25A11 mRNA	CTD	PMID:36331819
SLC25A11	Human	1,2-dimethylhydrazine	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of SLC25A11 mRNA	CTD	PMID:22206623
SLC25A11	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Slc25a11 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC25A11 mRNA	CTD	PMID:22206623
SLC25A11	Human	17alpha-ethynylestradiol	affects expression	ISO	Slc25a11 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of SLC25A11 mRNA	CTD	PMID:17555576
SLC25A11	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Slc25a11 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SLC25A11 mRNA	CTD	PMID:21570461
SLC25A11	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SLC25A11 mRNA	CTD	PMID:33387578
SLC25A11	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	bisphenol S results in decreased expression of SLC25A11 mRNA	CTD	PMID:33297965
SLC25A11	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	Slc25a11 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC25A11 mRNA	CTD	PMID:36041667
SLC25A11	Human	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of SLC25A11 protein	CTD	PMID:34186270
SLC25A11	Human	acrylamide	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Acrylamide results in increased expression of SLC25A11 mRNA	CTD	PMID:28959563
SLC25A11	Human	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of SLC25A11 mRNA	CTD	PMID:32763439
SLC25A11	Human	acrylamide	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	Acrylamide results in increased expression of SLC25A11 mRNA	CTD	PMID:30807115
SLC25A11	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of SLC25A11 mRNA	CTD	PMID:33167477
SLC25A11	Human	ammonium chloride	affects expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of SLC25A11 mRNA	CTD	PMID:16483693
SLC25A11	Human	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of SLC25A11 mRNA and aristolochic acid I results in decreased expression of SLC25A11 protein	CTD	PMID:33212167
SLC25A11	Human	arsenite(3-)	multiple interactions	EXP		6480464	arsenite inhibits the reaction [G3BP1 protein binds to SLC25A11 protein]	CTD	PMID:32406909
SLC25A11	Human	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of SLC25A11 mRNA	CTD	PMID:22378314
SLC25A11	Human	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of SLC25A11 mRNA	CTD	PMID:20106945
SLC25A11	Human	benzo[a]pyrene	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SLC25A11 mRNA	CTD	PMID:22228805
SLC25A11	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of SLC25A11 mRNA	CTD	PMID:35550907
SLC25A11	Human	bisphenol A	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of SLC25A11 mRNA	CTD	PMID:25181051
SLC25A11	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SLC25A11 protein	CTD	PMID:37567409
SLC25A11	Human	bisphenol A	multiple interactions	ISO	Slc25a11 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC25A11 mRNA	CTD	PMID:36041667
SLC25A11	Human	bisphenol A	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	bisphenol A results in increased expression of SLC25A11 mRNA	CTD	PMID:33221593
SLC25A11	Human	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of SLC25A11 protein	CTD	PMID:34186270
SLC25A11	Human	Bisphenol B	increases expression	EXP		6480464	bisphenol B results in increased expression of SLC25A11 protein	CTD	PMID:34186270
SLC25A11	Human	bisphenol F	multiple interactions	ISO	Slc25a11 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC25A11 mRNA	CTD	PMID:36041667
SLC25A11	Human	bortezomib	decreases expression	EXP		6480464	Bortezomib results in decreased expression of SLC25A11 mRNA	CTD	PMID:20977926
SLC25A11	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC25A11 mRNA	CTD	PMID:35301059
SLC25A11	Human	cadmium dichloride	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Cadmium Chloride results in increased expression of SLC25A11 mRNA	CTD	PMID:33453195
SLC25A11	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC25A11 mRNA	CTD	PMID:35301059
SLC25A11	Human	carbon nanotube	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Nanotubes and Carbon results in decreased expression of SLC25A11 mRNA	CTD	PMID:25620056
SLC25A11	Human	chlorpyrifos	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of SLC25A11 mRNA	CTD	PMID:37019170
SLC25A11	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of SLC25A11 mRNA	CTD	PMID:27392435
SLC25A11	Human	clobetasol	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	Clobetasol results in increased expression of SLC25A11 mRNA	CTD	PMID:27462272
SLC25A11	Human	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of SLC25A11 mRNA	CTD	PMID:19320972 and PMID:19376846
SLC25A11	Human	cobalt dichloride	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	cobaltous chloride results in decreased expression of SLC25A11 mRNA	CTD	PMID:24386269
SLC25A11	Human	copper atom	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Copper results in decreased expression of SLC25A11 mRNA	CTD	PMID:22465980
SLC25A11	Human	copper(0)	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Copper results in decreased expression of SLC25A11 mRNA	CTD	PMID:22465980
SLC25A11	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of SLC25A11 mRNA	CTD	PMID:19549813
SLC25A11	Human	corosolic acid	decreases expression	EXP		6480464	corosolic acid results in decreased expression of SLC25A11 mRNA	CTD	PMID:37939859
SLC25A11	Human	coumestrol	increases expression	EXP		6480464	Coumestrol results in increased expression of SLC25A11 mRNA	CTD	PMID:19167446
SLC25A11	Human	coumestrol	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SLC25A11 mRNA	CTD	PMID:19167446
SLC25A11	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of SLC25A11 mRNA	CTD	PMID:20106945 and PMID:25562108
SLC25A11	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of SLC25A11 mRNA	CTD	PMID:37042841
SLC25A11	Human	dibutyl phthalate	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of SLC25A11 mRNA	CTD	PMID:21266533
SLC25A11	Human	dibutyl phthalate	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Dibutyl Phthalate results in decreased expression of SLC25A11 mRNA	CTD	PMID:21266533
SLC25A11	Human	Diisodecyl phthalate	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	diisodecyl phthalate results in increased expression of SLC25A11 mRNA	CTD	PMID:25270620
SLC25A11	Human	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of SLC25A11 mRNA	CTD	PMID:29803840
SLC25A11	Human	doxorubicin	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Doxorubicin results in decreased expression of SLC25A11 protein	CTD	PMID:34246718
SLC25A11	Human	Enterolactone	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SLC25A11 mRNA	CTD	PMID:19167446
SLC25A11	Human	epoxiconazole	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	epoxiconazole results in decreased expression of SLC25A11 mRNA	CTD	PMID:35436446
SLC25A11	Human	folic acid	multiple interactions	ISO	Slc25a11 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC25A11 mRNA	CTD	PMID:22206623
SLC25A11	Human	hyaluronic acid	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Hyaluronic Acid analog results in decreased expression of SLC25A11 protein	CTD	PMID:23178681
SLC25A11	Human	hydrogen peroxide	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Hydrogen Peroxide results in decreased expression of SLC25A11 mRNA and Hydrogen Peroxide results in decreased expression of SLC25A11 protein	CTD	PMID:23178681 and PMID:24349266
SLC25A11	Human	isotretinoin	decreases expression	EXP		6480464	Isotretinoin results in decreased expression of SLC25A11 mRNA	CTD	PMID:20436886
SLC25A11	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of SLC25A11 protein	CTD	PMID:32959892
SLC25A11	Human	Mesaconitine	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	mesaconitine results in increased expression of SLC25A11 protein	CTD	PMID:37182599
SLC25A11	Human	methapyrilene	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Methapyrilene results in decreased expression of SLC25A11 mRNA	CTD	PMID:30467583
SLC25A11	Human	methyl methanesulfonate	decreases expression	EXP		6480464	Methyl Methanesulfonate results in decreased expression of SLC25A11 mRNA	CTD	PMID:23649840
SLC25A11	Human	mitoxantrone	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Mitoxantrone results in decreased expression of SLC25A11 protein	CTD	PMID:34246718
SLC25A11	Human	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of SLC25A11 mRNA	CTD	PMID:23195993
SLC25A11	Human	nitrates	multiple interactions	ISO	Slc25a11 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SLC25A11 mRNA	CTD	PMID:35964746
SLC25A11	Human	oleic acid	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Oleic Acid results in decreased expression of SLC25A11 mRNA	CTD	PMID:24349266
SLC25A11	Human	paracetamol	affects expression	ISO	Slc25a11 (Mus musculus)	6480464	Acetaminophen affects the expression of SLC25A11 mRNA	CTD	PMID:17562736
SLC25A11	Human	paracetamol	increases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Acetaminophen results in increased expression of SLC25A11 mRNA	CTD	PMID:33387578
SLC25A11	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SLC25A11 mRNA	CTD	PMID:25704631
SLC25A11	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Slc25a11 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC25A11 mRNA	CTD	PMID:36331819
SLC25A11	Human	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of SLC25A11 protein	CTD	PMID:26879310
SLC25A11	Human	resveratrol	increases expression	ISO	Slc25a11 (Mus musculus)	6480464	resveratrol results in increased expression of SLC25A11 mRNA	CTD	PMID:22610192
SLC25A11	Human	resveratrol	multiple interactions	EXP		6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of SLC25A11 mRNA	CTD	PMID:23557933
SLC25A11	Human	resveratrol	increases expression	EXP		6480464	resveratrol results in increased expression of SLC25A11 mRNA	CTD	PMID:19167446
SLC25A11	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of SLC25A11 mRNA	CTD	PMID:38568856
SLC25A11	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of SLC25A11 mRNA	CTD	PMID:34032870
SLC25A11	Human	sodium fluoride	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of SLC25A11 protein	CTD	PMID:28918527
SLC25A11	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of SLC25A11 mRNA	CTD	PMID:31533062
SLC25A11	Human	tamoxifen	affects expression	ISO	Slc25a11 (Mus musculus)	6480464	Tamoxifen affects the expression of SLC25A11 mRNA	CTD	PMID:17555576
SLC25A11	Human	tetrachloromethane	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in decreased expression of SLC25A11 mRNA	CTD	PMID:16644059 and PMID:31150632
SLC25A11	Human	tetrachloromethane	decreases expression	ISO	Slc25a11 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of SLC25A11 mRNA	CTD	PMID:31919559
SLC25A11	Human	tetrachloromethane	multiple interactions	ISO	Slc25a11 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SLC25A11 mRNA]	CTD	PMID:31150632
SLC25A11	Human	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of SLC25A11 mRNA	CTD	PMID:22378314
SLC25A11	Human	thioacetamide	decreases expression	ISO	Slc25a11 (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of SLC25A11 mRNA	CTD	PMID:34492290
SLC25A11	Human	thiram	decreases expression	EXP		6480464	Thiram results in decreased expression of SLC25A11 mRNA	CTD	PMID:38568856
SLC25A11	Human	titanium dioxide	decreases methylation	ISO	Slc25a11 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SLC25A11 promoter alternative form	CTD	PMID:35295148
SLC25A11	Human	titanium dioxide	increases methylation	ISO	Slc25a11 (Mus musculus)	6480464	titanium dioxide results in increased methylation of SLC25A11 gene	CTD	PMID:35295148
SLC25A11	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of SLC25A11 mRNA	CTD	PMID:37042841
SLC25A11	Human	tunicamycin	decreases expression	EXP		6480464	Tunicamycin results in decreased expression of SLC25A11 mRNA	CTD	PMID:22378314
SLC25A11	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of SLC25A11 gene	CTD	PMID:29154799
SLC25A11	Human	vincristine	decreases expression	EXP		6480464	Vincristine results in decreased expression of SLC25A11 mRNA	CTD	PMID:23649840
SLC25A11	Human	zidovudine	increases expression	EXP		6480464	Zidovudine results in increased expression of SLC25A11 mRNA	CTD	PMID:24292225

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	alpha-ketoglutarate transport	involved_in	IEA	GO:0015367	150520179		GOC	GO_REF:0000108
SLC25A11	Human	gluconeogenesis	involved_in	IEA	UniProtKB:Q9CR62 and ensembl:ENSMUSP00000014750	150520179		Ensembl	GO_REF:0000107
SLC25A11	Human	lipid transport	involved_in	IEA	UniProtKB-KW:KW-0445	150520179		UniProt	GO_REF:0000043
SLC25A11	Human	malate transmembrane transport	involved_in	IEA	GO:0015367	150520179		GOC	GO_REF:0000108
SLC25A11	Human	malate-aspartate shuttle	involved_in	IEA	UniProtKB:Q9CR62 and ensembl:ENSMUSP00000014750	150520179		Ensembl	GO_REF:0000107
SLC25A11	Human	malate-aspartate shuttle	involved_in	IMP		150520179	PMID:37647199	FlyBase	PMID:37647199
SLC25A11	Human	transmembrane transport	involved_in	IEA	GO:0015297 and GO:0022857	150520179		GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	membrane	located_in	IEA	UniRule:UR000413536	150520179		UniProt	GO_REF:0000104
SLC25A11	Human	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	150520179		UniProt	GO_REF:0000044
SLC25A11	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
SLC25A11	Human	mitochondrial inner membrane	located_in	IEA	UniProtKB-KW:KW-0999	150520179		UniProt	GO_REF:0000043
SLC25A11	Human	mitochondrial inner membrane	is_active_in	IEA	UniProtKB:Q9CR62 and ensembl:ENSMUSP00000014750	150520179		Ensembl	GO_REF:0000107
SLC25A11	Human	mitochondrial inner membrane	located_in	IEA	UniProtKB-SubCell:SL-0168	150520179		UniProt	GO_REF:0000044
SLC25A11	Human	mitochondrial inner membrane	located_in	TAS		150520179	PMID:1457818	Reactome	PMID:1457818 more ...
SLC25A11	Human	mitochondrion	located_in	HDA		150520179	PMID:20833797	UniProt	PMID:20833797
SLC25A11	Human	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	150520179		UniProt	GO_REF:0000043
SLC25A11	Human	mitochondrion	located_in	HTP		150520179	PMID:34800366	FlyBase	PMID:34800366
SLC25A11	Human	nucleus	located_in	HDA		150520179	PMID:21630459	UniProt	PMID:21630459
SLC25A11	Human	plasma membrane	located_in	TAS		150520179	PMID:1457818	PINC	PMID:1457818

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	alpha-ketoglutarate transmembrane transporter activity		ISO	Slc25a11 (Rattus norvegicus)	9068941		RGD	PMID:12939596 and REF_RGD_ID:1299466
SLC25A11	Human	antiporter activity	enables	IEA	UniProtKB-KW:KW-0050	150520179		UniProt	GO_REF:0000043
SLC25A11	Human	oxoglutarate:malate antiporter activity	enables	TAS		150520179	PMID:1457818	PINC	PMID:1457818
SLC25A11	Human	oxoglutarate:malate antiporter activity	enables	IEA	UniProtKB:Q9CR62 and ensembl:ENSMUSP00000014750	150520179		Ensembl	GO_REF:0000107
SLC25A11	Human	protein binding	enables	IPI	UniProtKB:O43865 more ...	150520179	PMID:32814053	IntAct	PMID:32814053
SLC25A11	Human	protein binding	enables	IPI	UniProtKB:A0A096LP01	150520179	PMID:37009826	UniProt	PMID:37009826
SLC25A11	Human	RNA binding	enables	HDA		150520179	PMID:22681889	UniProt	PMID:22681889
SLC25A11	Human	transmembrane transporter activity	enables	IBA	FB:FBgn0027610 more ...	150520179		GO_Central	GO_REF:0000033

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	fructose-1,6-bisphosphatase deficiency pathway		EXP		10402751		SMPDB	SMP:00562
SLC25A11	Human	gluconeogenesis pathway		EXP		10402751		SMPDB	SMP:00128
SLC25A11	Human	glycogen storage disease type Ia pathway		EXP		10402751		SMPDB	SMP:00581
SLC25A11	Human	glycogen storage disease type Ia pathway		EXP		10402751		SMPDB	SMP:00374
SLC25A11	Human	glycogen storage disease type Ib pathway		EXP		10402751		SMPDB	SMP:00573
SLC25A11	Human	nicotinamide adenine dinucleotide metabolic pathway		EXP		10402751		SMPDB	SMP:00129
SLC25A11	Human	phosphoenolpyruvate carboxykinase deficiency pathway		EXP		10402751		SMPDB	SMP:00560
SLC25A11	Human	triosephosphate isomerase deficiency pathway		EXP		10402751		SMPDB	SMP:00563

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SLC25A11	Human	Adrenal pheochromocytoma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Aniridia		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Arachnoid hemangiomatosis		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Autosomal dominant inheritance		IAGP		8699517		HPO	MIM:618464
SLC25A11	Human	Cerebral hemorrhage		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Chest pain		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Conductive hearing impairment		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Congestive heart failure		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Cranial nerve compression		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Dysphonia		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Elevated circulating calcitonin concentration		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Elevated circulating catecholamine level		IAGP		8699517		HPO	MIM:618464
SLC25A11	Human	Elevated urinary dopamine level		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Elevated urinary epinephrine level		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Elevated urinary norepinephrine level		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Episodic abdominal pain		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Episodic hyperhidrosis		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Episodic paroxysmal anxiety		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Extraadrenal pheochromocytoma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Fatigue		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Flushing		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Glomerular sclerosis		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Hematuria		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Hypercalcemia		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Hypertension		IAGP		8699517		HPO	MIM:618464
SLC25A11	Human	Hypertension associated with pheochromocytoma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Hypertensive retinopathy		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Nausea		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Pallor		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Palpitations		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Panic attack		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Paraganglioma		IAGP		8699517		HPO	MIM:618464
SLC25A11	Human	Paraganglioma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Paraganglioma of head and neck		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Paroxysmal vertigo		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Positive regitine blocking test		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Proteinuria		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Pulsatile tinnitus		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Recurrent paroxysmal headache		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Renal cell carcinoma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Retinal capillary hemangioma		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Sinus tachycardia		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Tremor		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Vocal cord paralysis		IAGP		8699517		HPO	ORPHA:29072
SLC25A11	Human	Weight loss		IAGP		8699517		HPO	ORPHA:29072

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1457818	PMID:8597574	PMID:8619474	PMID:8769314	PMID:9110174	PMID:9639574	PMID:10072597	PMID:12477932	PMID:12939596	PMID:15489334	PMID:16169070	PMID:16712791
PMID:16920706	PMID:17082780	PMID:17314511	PMID:19615732	PMID:19913121	PMID:20186120	PMID:20562859	PMID:20628086	PMID:20833797	PMID:20877624	PMID:21081666	PMID:21448454
PMID:21500544	PMID:21630459	PMID:21873635	PMID:22268729	PMID:22678362	PMID:22681889	PMID:22810586	PMID:22939629	PMID:22990118	PMID:23054077	PMID:23125841	PMID:23246001
PMID:23266187	PMID:23464991	PMID:23658844	PMID:23798571	PMID:24457600	PMID:25315684	PMID:25332235	PMID:25437307	PMID:25798074	PMID:25852190	PMID:25921289	PMID:25963833
PMID:26170170	PMID:26186194	PMID:26344197	PMID:26485645	PMID:26496610	PMID:26549023	PMID:26618866	PMID:26752685	PMID:26972000	PMID:27025967	PMID:27218139	PMID:27342126
PMID:27499296	PMID:27503909	PMID:27684187	PMID:28186131	PMID:28242297	PMID:28298427	PMID:28443643	PMID:28514442	PMID:28515276	PMID:28718761	PMID:28775156	PMID:28883622
PMID:28902428	PMID:29053956	PMID:29128334	PMID:29229926	PMID:29298432	PMID:29331416	PMID:29431636	PMID:29467282	PMID:29507755	PMID:29509190	PMID:29509794	PMID:29568061
PMID:29615496	PMID:29844126	PMID:29845934	PMID:29955894	PMID:29991511	PMID:30154076	PMID:30209976	PMID:30425250	PMID:30442662	PMID:30455355	PMID:30462309	PMID:30463901
PMID:30472188	PMID:30554943	PMID:30575818	PMID:30581152	PMID:30619736	PMID:30686754	PMID:30833792	PMID:30940648	PMID:30948266	PMID:31059266	PMID:31091453	PMID:31298480
PMID:31318583	PMID:31527615	PMID:31536960	PMID:31586073	PMID:31594818	PMID:31620119	PMID:31732153	PMID:31753913	PMID:31796584	PMID:31822558	PMID:31871319	PMID:31980649
PMID:31995728	PMID:32129710	PMID:32239614	PMID:32322062	PMID:32687490	PMID:32707033	PMID:32807901	PMID:32814053	PMID:32929329	PMID:33022573	PMID:33067418	PMID:33567341
PMID:33658012	PMID:33729478	PMID:33731348	PMID:33777788	PMID:33961781	PMID:34079125	PMID:34687317	PMID:34709727	PMID:34732716	PMID:34800366	PMID:34841685	PMID:34901782
PMID:35013218	PMID:35031058	PMID:35032548	PMID:35140242	PMID:35182466	PMID:35241646	PMID:35256949	PMID:35384245	PMID:35439318	PMID:35563538	PMID:35676659	PMID:35777956
PMID:35819319	PMID:35850772	PMID:35915203	PMID:35944360	PMID:36042349	PMID:36057605	PMID:36114006	PMID:36129980	PMID:36168628	PMID:36180527	PMID:36215168	PMID:36232890
PMID:36244648	PMID:36282215	PMID:36339263	PMID:36526897	PMID:36574265	PMID:36779763	PMID:37009826	PMID:37117185	PMID:37120454	PMID:37132043	PMID:37167062	PMID:37223481
PMID:37314216	PMID:37317656	PMID:37616343	PMID:37647199	PMID:37667382	PMID:37768083	PMID:37827155	PMID:37848033	PMID:38113892	PMID:38280479	PMID:38569033	PMID:38697112
PMID:38777146	PMID:39098523	PMID:39231216

SLC25A11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	4,937,130 - 4,940,046 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	4,937,130 - 4,940,053 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	4,840,425 - 4,843,341 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	4,781,349 - 4,784,063 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	4,781,348 - 4,784,063	NCBI
Celera	17	4,855,235 - 4,858,273 (-)	NCBI		Celera
Cytogenetic Map	17	p13.2	NCBI
HuRef	17	4,728,014 - 4,731,052 (-)	NCBI		HuRef
CHM1_1	17	4,849,762 - 4,852,800 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	4,827,477 - 4,830,394 (-)	NCBI		T2T-CHM13v2.0

Slc25a11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	70,534,845 - 70,538,356 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	70,535,022 - 70,538,305 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	70,644,019 - 70,647,531 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	70,644,196 - 70,647,479 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	70,457,698 - 70,460,495 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	70,460,391 - 70,463,188 (-)	NCBI		MGSCv36	mm8
Celera	11	78,195,171 - 78,197,968 (-)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	43.21	NCBI

Slc25a11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,856,209 - 55,859,060 (-)	NCBI		GRCr8
mRatBN7.2	10	55,357,590 - 55,360,441 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,357,597 - 55,360,410 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	60,038,200 - 60,041,051 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,526,706 - 59,529,557 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	55,025,812 - 55,028,663 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,265,903 - 57,268,018 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,265,704 - 57,268,081 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	57,011,497 - 57,013,612 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	57,524,561 - 57,526,676 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	57,538,183 - 57,540,299 (-)	NCBI
Celera	10	54,503,719 - 54,505,834 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

Slc25a11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	10,349,378 - 10,355,368 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	10,349,378 - 10,352,649 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC25A11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	12,547,345 - 12,550,022 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	14,515,703 - 14,518,345 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	4,985,477 - 4,988,348 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	4,973,000 - 4,975,878 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	4,973,000 - 4,975,878 (-)	Ensembl	panpan1.1		panPan2

SLC25A11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	31,676,826 - 31,680,138 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	31,675,740 - 31,679,933 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	31,814,780 - 31,818,149 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	31,780,196 - 31,783,564 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	31,780,804 - 31,783,559 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	31,746,734 - 31,750,103 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	31,706,440 - 31,709,808 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	31,882,816 - 31,886,184 (+)	NCBI		UU_Cfam_GSD_1.0

Slc25a11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	53,127,002 - 53,129,890 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936677	2,770,964 - 2,776,022 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936677	2,770,969 - 2,773,973 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC25A11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	51,970,806 - 51,975,548 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	51,970,794 - 51,973,668 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,039,520 - 54,042,613 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC25A11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	4,418,555 - 4,421,745 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	4,416,259 - 4,421,162 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	17,212,060 - 17,215,298 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc25a11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	8,795,083 - 8,797,882 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	8,795,077 - 8,797,871 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in SLC25A11
42 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 17p13.3-13.2(chr17:193307-5652222)x1	copy number loss	See cases [RCV000053384]	Chr17:193307..5652222 [GRCh38] Chr17:45835..5555542 [GRCh37] Chr17:43098..5496266 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.2-13.1(chr17:3601515-7178024)x1	copy number loss	See cases [RCV000053406]	Chr17:3601515..7178024 [GRCh38] Chr17:3504809..7081343 [GRCh37] Chr17:3451558..7022067 [NCBI36] Chr17:17p13.2-13.1	pathogenic
NM_001165417.1(SLC25A11):c.551A>G (p.Asn184Ser)	single nucleotide variant	Malignant melanoma [RCV000071571]	Chr17:4938392 [GRCh38] Chr17:4841687 [GRCh37] Chr17:4782432 [NCBI36] Chr17:17p13.2	not provided
GRCh38/hg38 17p13.3-13.2(chr17:2062380-5258340)x1	copy number loss	See cases [RCV000133721]	Chr17:2062380..5258340 [GRCh38] Chr17:1965674..5161635 [GRCh37] Chr17:1912424..5102359 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.1(chr17:162088-6959050)x1	copy number loss	See cases [RCV000134135]	Chr17:162088..6959050 [GRCh38] Chr17:45835..6862369 [GRCh37] Chr17:11879..6803093 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.3-13.1(chr17:198748-7491129)x3	copy number gain	See cases [RCV000134970]	Chr17:198748..7491129 [GRCh38] Chr17:50690..7394448 [GRCh37] Chr17:48539..7335172 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.2(chr17:4044302-5943772)x1	copy number loss	See cases [RCV000135548]	Chr17:4044302..5943772 [GRCh38] Chr17:3947596..5847092 [GRCh37] Chr17:3894345..5787816 [NCBI36] Chr17:17p13.2	likely pathogenic
GRCh38/hg38 17p13.3-13.1(chr17:162016-7697012)x1	copy number loss	See cases [RCV000138214]	Chr17:162016..7697012 [GRCh38] Chr17:45835..7600330 [GRCh37] Chr17:11807..7541055 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.3-12(chr17:162016-12343901)x3	copy number gain	See cases [RCV000138531]	Chr17:162016..12343901 [GRCh38] Chr17:45835..12247218 [GRCh37] Chr17:11807..12187943 [NCBI36] Chr17:17p13.3-12	pathogenic
GRCh38/hg38 17p13.2(chr17:4092608-5354473)x3	copy number gain	See cases [RCV000139650]	Chr17:4092608..5354473 [GRCh38] Chr17:3995902..5257768 [GRCh37] Chr17:3942651..5198492 [NCBI36] Chr17:17p13.2	likely benign
GRCh38/hg38 17p13.2(chr17:4915519-5197126)x1	copy number loss	See cases [RCV000141706]	Chr17:4915519..5197126 [GRCh38] Chr17:4818814..5100421 [GRCh37] Chr17:4759591..5041145 [NCBI36] Chr17:17p13.2	likely pathogenic\|uncertain significance
GRCh38/hg38 17p13.3-13.2(chr17:150732-5935377)x1	copy number loss	See cases [RCV000141658]	Chr17:150732..5935377 [GRCh38] Chr17:525..5838697 [GRCh37] Chr17:525..5779421 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-12(chr17:150732-14764202)x3	copy number gain	See cases [RCV000142236]	Chr17:150732..14764202 [GRCh38] Chr17:525..14667519 [GRCh37] Chr17:525..14608244 [NCBI36] Chr17:17p13.3-12	pathogenic
GRCh37/hg19 17p13.2(chr17:4762588-4844009)x3	copy number gain	See cases [RCV000446549]	Chr17:4762588..4844009 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.3-13.2(chr17:1751557-5378509)x1	copy number loss	See cases [RCV000445994]	Chr17:1751557..5378509 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.1(chr17:1113102-6742486)	copy number gain	See cases [RCV000445679]	Chr17:1113102..6742486 [GRCh37] Chr17:17p13.3-13.1	pathogenic
GRCh37/hg19 17p13.2(chr17:4633847-4856516)x1	copy number loss	See cases [RCV000510443]	Chr17:4633847..4856516 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)	copy number gain	See cases [RCV000511439]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-12(chr17:525-15027737)x3	copy number gain	See cases [RCV000511786]	Chr17:525..15027737 [GRCh37] Chr17:17p13.3-12	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)x3	copy number gain	See cases [RCV000512441]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-12(chr17:525-11186432)x3	copy number gain	not provided [RCV000683866]	Chr17:525..11186432 [GRCh37] Chr17:17p13.3-12	pathogenic
GRCh37/hg19 17p13.2(chr17:4475016-4884701)x3	copy number gain	not provided [RCV000683882]	Chr17:4475016..4884701 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.2(chr17:4633847-4926646)x3	copy number gain	not provided [RCV000683883]	Chr17:4633847..4926646 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.2(chr17:4036861-5174346)x3	copy number gain	not provided [RCV000683881]	Chr17:4036861..5174346 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.3-q25.3(chr17:7214-81058310)x3	copy number gain	not provided [RCV000739320]	Chr17:7214..81058310 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:12344-81057996)x3	copy number gain	not provided [RCV000739325]	Chr17:12344..81057996 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:8547-81060040)x3	copy number gain	not provided [RCV000739324]	Chr17:8547..81060040 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.2(chr17:3336162-4918458)x1	copy number loss	not provided [RCV000739374]	Chr17:3336162..4918458 [GRCh37] Chr17:17p13.2	likely pathogenic
NM_003562.5(SLC25A11):c.107_108del (p.Thr36fs)	deletion	Paragangliomas 6 [RCV000785995]	Chr17:4939200..4939201 [GRCh38] Chr17:4842495..4842496 [GRCh37] Chr17:17p13.2	pathogenic
NM_003562.5(SLC25A11):c.439A>G (p.Met147Val)	single nucleotide variant	Paragangliomas 6 [RCV000785992]	Chr17:4938785 [GRCh38] Chr17:4842080 [GRCh37] Chr17:17p13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:47546-6287620)	copy number gain	Chromosome 17P13.3, telomeric, duplication syndrome [RCV000767586]	Chr17:47546..6287620 [GRCh37] Chr17:17p13.3-13.2	pathogenic
NM_003562.5(SLC25A11):c.715C>A (p.Pro239Thr)	single nucleotide variant	Paragangliomas 6 [RCV000785991]	Chr17:4938176 [GRCh38] Chr17:4841471 [GRCh37] Chr17:17p13.2	pathogenic
NM_003562.5(SLC25A11):c.708C>T (p.Ala236=)	single nucleotide variant	Paragangliomas 6 [RCV000785993]	Chr17:4938183 [GRCh38] Chr17:4841478 [GRCh37] Chr17:17p13.2	pathogenic
NC_000017.10:g.(?_4802011)_(4850135_?)dup	duplication	Congenital myasthenic syndrome 4A [RCV000795439]	Chr17:4898716..4946840 [GRCh38] Chr17:4802011..4850135 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.421G>A (p.Glu141Lys)	single nucleotide variant	Paragangliomas 6 [RCV000785994]	Chr17:4938803 [GRCh38] Chr17:4842098 [GRCh37] Chr17:17p13.2	pathogenic
GRCh37/hg19 17p13.2(chr17:3759126-6128911)x1	copy number loss	not provided [RCV000849625]	Chr17:3759126..6128911 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.3-13.2(chr17:8547-5627408)x1	copy number loss	See cases [RCV001007429]	Chr17:8547..5627408 [GRCh37] Chr17:17p13.3-13.2	pathogenic
NM_003562.5(SLC25A11):c.473G>A (p.Arg158His)	single nucleotide variant	not specified [RCV004292979]	Chr17:4938585 [GRCh38] Chr17:4841880 [GRCh37] Chr17:17p13.2	uncertain significance
NC_000017.11:g.(?_4898726)_(5024161_?)dup	duplication	Congenital myasthenic syndrome 4A [RCV003117706]\|Spastic ataxia 2 [RCV001032478]	Chr17:4802021..4927456 [GRCh37] Chr17:17p13.2	uncertain significance
NC_000017.11:g.(?_4898726)_(4948404_?)del	deletion	Congenital myasthenic syndrome 4A [RCV001033817]	Chr17:4802021..4851699 [GRCh37] Chr17:17p13.2	pathogenic
NM_003562.5(SLC25A11):c.262C>T (p.Leu88=)	single nucleotide variant	SLC25A11-related disorder [RCV003963209]\|not provided [RCV001311477]	Chr17:4938962 [GRCh38] Chr17:4842257 [GRCh37] Chr17:17p13.2	benign\|likely benign
NM_003562.5(SLC25A11):c.828C>A (p.Phe276Leu)	single nucleotide variant	not provided [RCV003238473]\|not specified [RCV004040743]	Chr17:4937858 [GRCh38] Chr17:4841153 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.2(chr17:4113551-5023913)	copy number loss	not specified [RCV002052580]	Chr17:4113551..5023913 [GRCh37] Chr17:17p13.2	uncertain significance
Single allele	duplication	7p22.1 microduplication syndrome [RCV002227783]	Chr17:4772213..5119909 [GRCh38] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.185A>G (p.Lys62Arg)	single nucleotide variant	not specified [RCV004330739]	Chr17:4939123 [GRCh38] Chr17:4842418 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.571G>A (p.Ala191Thr)	single nucleotide variant	not specified [RCV004094489]	Chr17:4938405 [GRCh38] Chr17:4841700 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.671G>A (p.Cys224Tyr)	single nucleotide variant	not provided [RCV005099073]\|not specified [RCV004223692]	Chr17:4938220 [GRCh38] Chr17:4841515 [GRCh37] Chr17:17p13.2	likely benign\|uncertain significance
GRCh37/hg19 17p13.2(chr17:4658216-5266343)x3	copy number gain	not provided [RCV002475693]	Chr17:4658216..5266343 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.277A>T (p.Thr93Ser)	single nucleotide variant	not specified [RCV004112170]	Chr17:4938947 [GRCh38] Chr17:4842242 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.773A>C (p.Glu258Ala)	single nucleotide variant	not specified [RCV004169706]	Chr17:4938039 [GRCh38] Chr17:4841334 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.29G>A (p.Gly10Asp)	single nucleotide variant	not specified [RCV004178360]	Chr17:4939882 [GRCh38] Chr17:4843177 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.472C>G (p.Arg158Gly)	single nucleotide variant	not provided [RCV005099860]\|not specified [RCV004171983]	Chr17:4938586 [GRCh38] Chr17:4841881 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.436C>T (p.Arg146Cys)	single nucleotide variant	not specified [RCV004269091]	Chr17:4938788 [GRCh38] Chr17:4842083 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.422A>G (p.Glu141Gly)	single nucleotide variant	not specified [RCV004278452]	Chr17:4938802 [GRCh38] Chr17:4842097 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh38/hg38 17p13.3-12(chr17:165730-11404096)x3	copy number gain	Chromosome 17p13.3 duplication syndrome [RCV003327726]	Chr17:165730..11404096 [GRCh38] Chr17:17p13.3-12	pathogenic
NM_003562.5(SLC25A11):c.518G>A (p.Arg173Gln)	single nucleotide variant	not provided [RCV005104069]\|not specified [RCV004341709]	Chr17:4938540 [GRCh38] Chr17:4841835 [GRCh37] Chr17:17p13.2	likely benign\|uncertain significance
NM_003562.5(SLC25A11):c.20C>T (p.Ala7Val)	single nucleotide variant	not provided [RCV003575531]	Chr17:4939891 [GRCh38] Chr17:4843186 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.360G>C (p.Leu120=)	single nucleotide variant	not provided [RCV005084935]	Chr17:4938864 [GRCh38] Chr17:4842159 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.547-20C>T	single nucleotide variant	not provided [RCV003549673]	Chr17:4938449 [GRCh38] Chr17:4841744 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.638-16G>A	single nucleotide variant	not provided [RCV003549601]	Chr17:4938269 [GRCh38] Chr17:4841564 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.849G>A (p.Thr283=)	single nucleotide variant	not provided [RCV003566768]	Chr17:4937837 [GRCh38] Chr17:4841132 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.738-14G>A	single nucleotide variant	not provided [RCV003681532]	Chr17:4938088 [GRCh38] Chr17:4841383 [GRCh37] Chr17:17p13.2	benign
NM_003562.5(SLC25A11):c.738-20C>A	single nucleotide variant	not provided [RCV003551468]	Chr17:4938094 [GRCh38] Chr17:4841389 [GRCh37] Chr17:17p13.2	likely benign
GRCh37/hg19 17p13.3-13.2(chr17:9474-6017500)x1	copy number loss	not specified [RCV003987214]	Chr17:9474..6017500 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-11.2(chr17:525-21510992)x3	copy number gain	not specified [RCV003987215]	Chr17:525..21510992 [GRCh37] Chr17:17p13.3-11.2	pathogenic
NM_003562.5(SLC25A11):c.432T>A (p.Leu144=)	single nucleotide variant	SLC25A11-related disorder [RCV003931882]	Chr17:4938792 [GRCh38] Chr17:4842087 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.538C>T (p.Leu180=)	single nucleotide variant	SLC25A11-related disorder [RCV003949705]	Chr17:4938520 [GRCh38] Chr17:4841815 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.57C>T (p.Ser19=)	single nucleotide variant	SLC25A11-related disorder [RCV003959290]	Chr17:4939854 [GRCh38] Chr17:4843149 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.576C>T (p.Val192=)	single nucleotide variant	SLC25A11-related disorder [RCV003972061]	Chr17:4938400 [GRCh38] Chr17:4841695 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.305A>C (p.Tyr102Ser)	single nucleotide variant	not specified [RCV004456396]	Chr17:4938919 [GRCh38] Chr17:4842214 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.310G>T (p.Val104Leu)	single nucleotide variant	not specified [RCV004456397]	Chr17:4938914 [GRCh38] Chr17:4842209 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.34A>G (p.Ile12Val)	single nucleotide variant	not specified [RCV004456398]	Chr17:4939877 [GRCh38] Chr17:4843172 [GRCh37] Chr17:17p13.2	uncertain significance
NC_000017.10:g.(?_422368)_(8285628_?)dup	duplication	not provided [RCV004581443]	Chr17:422368..8285628 [GRCh37] Chr17:17p13.3-13.1	uncertain significance
NM_003562.5(SLC25A11):c.895T>G (p.Phe299Val)	single nucleotide variant	not specified [RCV004859825]	Chr17:4937791 [GRCh38] Chr17:4841086 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.66C>T (p.Ser22=)	single nucleotide variant	not provided [RCV005107875]\|not specified [RCV004859820]	Chr17:4939845 [GRCh38] Chr17:4843140 [GRCh37] Chr17:17p13.2	likely benign\|uncertain significance
NM_003562.5(SLC25A11):c.209G>A (p.Ser70Asn)	single nucleotide variant	not specified [RCV004859821]	Chr17:4939099 [GRCh38] Chr17:4842394 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.811C>T (p.Arg271Cys)	single nucleotide variant	not specified [RCV004859826]	Chr17:4937875 [GRCh38] Chr17:4841170 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.17G>A (p.Ser6Asn)	single nucleotide variant	not specified [RCV004859819]	Chr17:4939894 [GRCh38] Chr17:4843189 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.812G>A (p.Arg271His)	single nucleotide variant	not specified [RCV004859822]	Chr17:4937874 [GRCh38] Chr17:4841169 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.754A>T (p.Met252Leu)	single nucleotide variant	not specified [RCV004859823]	Chr17:4938058 [GRCh38] Chr17:4841353 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.727G>A (p.Ala243Thr)	single nucleotide variant	not specified [RCV004859824]	Chr17:4938164 [GRCh38] Chr17:4841459 [GRCh37] Chr17:17p13.2	uncertain significance
GRCh37/hg19 17p13.2(chr17:4354194-5387525)x1	copy number loss	not provided [RCV004819391]	Chr17:4354194..5387525 [GRCh37] Chr17:17p13.2	pathogenic
GRCh37/hg19 17p13.2-12(chr17:4678235-14745263)x3	copy number gain	not provided [RCV004819316]	Chr17:4678235..14745263 [GRCh37] Chr17:17p13.2-12	pathogenic
NM_003562.5(SLC25A11):c.96-15T>C	single nucleotide variant	not provided [RCV005106126]	Chr17:4939227 [GRCh38] Chr17:4842522 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.737+9G>T	single nucleotide variant	not provided [RCV005193285]	Chr17:4938145 [GRCh38] Chr17:4841440 [GRCh37] Chr17:17p13.2	benign
NM_003562.5(SLC25A11):c.891C>T (p.Phe297=)	single nucleotide variant	not provided [RCV005120781]	Chr17:4937795 [GRCh38] Chr17:4841090 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.925C>T (p.Arg309Cys)	single nucleotide variant	not provided [RCV005108728]	Chr17:4937761 [GRCh38] Chr17:4841056 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.917C>T (p.Ala306Val)	single nucleotide variant	not provided [RCV005183971]	Chr17:4937769 [GRCh38] Chr17:4841064 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.638-9C>T	single nucleotide variant	not provided [RCV005076997]	Chr17:4938262 [GRCh38] Chr17:4841557 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.118C>T (p.Gln40Ter)	single nucleotide variant	not provided [RCV005143387]	Chr17:4939190 [GRCh38] Chr17:4842485 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.103_104delinsTT (p.Ala35Phe)	indel	not provided [RCV005133292]	Chr17:4939204..4939205 [GRCh38] Chr17:4842499..4842500 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.770C>T (p.Pro257Leu)	single nucleotide variant	not provided [RCV005113251]	Chr17:4938042 [GRCh38] Chr17:4841337 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.736C>A (p.Arg246=)	single nucleotide variant	not provided [RCV005117336]	Chr17:4938155 [GRCh38] Chr17:4841450 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.447C>T (p.Ala149=)	single nucleotide variant	not provided [RCV005191842]	Chr17:4938777 [GRCh38] Chr17:4842072 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.96-14_96-13del	microsatellite	not provided [RCV005116821]	Chr17:4939225..4939226 [GRCh38] Chr17:4842520..4842521 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.249-16C>T	single nucleotide variant	not provided [RCV005111099]	Chr17:4938991 [GRCh38] Chr17:4842286 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.857A>G (p.Tyr286Cys)	single nucleotide variant	not provided [RCV005187394]	Chr17:4937829 [GRCh38] Chr17:4841124 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.832C>T (p.Leu278=)	single nucleotide variant	not provided [RCV005185760]	Chr17:4937854 [GRCh38] Chr17:4841149 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.568C>T (p.Arg190Trp)	single nucleotide variant	not provided [RCV005110908]	Chr17:4938408 [GRCh38] Chr17:4841703 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.327G>C (p.Leu109=)	single nucleotide variant	not provided [RCV005110947]	Chr17:4938897 [GRCh38] Chr17:4842192 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.492G>C (p.Val164=)	single nucleotide variant	not provided [RCV005111183]	Chr17:4938566 [GRCh38] Chr17:4841861 [GRCh37] Chr17:17p13.2	uncertain significance
NM_003562.5(SLC25A11):c.547-17C>T	single nucleotide variant	not provided [RCV005110572]	Chr17:4938446 [GRCh38] Chr17:4841741 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.21C>G (p.Ala7=)	single nucleotide variant	not provided [RCV005113143]	Chr17:4939890 [GRCh38] Chr17:4843185 [GRCh37] Chr17:17p13.2	likely benign
NM_003562.5(SLC25A11):c.384C>T (p.Thr128=)	single nucleotide variant	not provided [RCV005113283]	Chr17:4938840 [GRCh38] Chr17:4842135 [GRCh37] Chr17:17p13.2	likely benign

Predicted Target Of

	Summary Value
Count of predictions:	1917
Count of miRNA genes:	706
Interacting mature miRNAs:	834
Transcripts:	ENST00000225665, ENST00000544061, ENST00000570543, ENST00000574710, ENST00000576951
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597593694	GWAS1650554_H	platelet count QTL GWAS1650554 (human)		5e-22	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597590973	GWAS1647833_H	platelet count QTL GWAS1647833 (human)		2e-20	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597593725	GWAS1650585_H	platelet count QTL GWAS1650585 (human)		4e-103	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597615062	GWAS1671922_H	platelet count QTL GWAS1671922 (human)		6e-67	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597307795	GWAS1403869_H	platelet count QTL GWAS1403869 (human)		2e-135	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597162364	GWAS1258438_H	platelet count QTL GWAS1258438 (human)		3e-85	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597182419	GWAS1278493_H	platelet glycoprotein ib alpha chain measurement QTL GWAS1278493 (human)		3e-38	platelet glycoprotein ib alpha chain measurement		17	4937573	4937574	Human
406963724	GWAS612700_H	platelet crit QTL GWAS612700 (human)		1e-12	platelet quantity (VT:0003179)	plateletcrit (CMO:0001349)	17	4937573	4937574	Human
597616211	GWAS1673071_H	platelet count QTL GWAS1673071 (human)		2e-84	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
406954606	GWAS603582_H	platelet count QTL GWAS603582 (human)		1e-19	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597593361	GWAS1650221_H	platelet count QTL GWAS1650221 (human)		5e-86	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597120167	GWAS1216241_H	platelet count QTL GWAS1216241 (human)		0.000009	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597593199	GWAS1650059_H	platelet count QTL GWAS1650059 (human)		2e-16	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597223438	GWAS1319512_H	calcium measurement QTL GWAS1319512 (human)		2e-09	calcium measurement	blood calcium level (CMO:0000502)	17	4937231	4937232	Human
406966455	GWAS615431_H	platelet component distribution width QTL GWAS615431 (human)		2e-26	platelet size trait (VT:0010457)	platelet distribution width (CMO:0001350)	17	4937573	4937574	Human
597593256	GWAS1650116_H	platelet count QTL GWAS1650116 (human)		3e-129	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597113761	GWAS1209835_H	platelet component distribution width QTL GWAS1209835 (human)		8e-81	platelet size trait (VT:0010457)	platelet distribution width (CMO:0001350)	17	4937573	4937574	Human
597237070	GWAS1333144_H	platelet count QTL GWAS1333144 (human)		6e-40	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597593609	GWAS1650469_H	platelet count QTL GWAS1650469 (human)		6e-24	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597613733	GWAS1670593_H	platelet count QTL GWAS1670593 (human)		1e-74	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597592928	GWAS1649788_H	platelet count QTL GWAS1649788 (human)		1e-32	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597086793	GWAS1182867_H	platelet count QTL GWAS1182867 (human)		3e-170	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human
597087017	GWAS1183091_H	platelet count QTL GWAS1183091 (human)		5e-73	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	17	4937573	4937574	Human

STS-T79192

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	4,840,900 - 4,841,050	UniSTS	GRCh37
Build 36	17	4,781,645 - 4,781,795	RGD	NCBI36
Celera	17	4,855,711 - 4,855,861	RGD
Cytogenetic Map	17	p13.3	UniSTS
HuRef	17	4,728,490 - 4,728,640	UniSTS
GeneMap99-GB4 RH Map	17	39.78	UniSTS
NCBI RH Map	17	54.6	UniSTS

SLC25A11_3257.2

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	4,840,521 - 4,841,138	UniSTS	GRCh37
Build 36	17	4,781,265 - 4,781,883	RGD	NCBI36
Celera	17	4,855,331 - 4,855,949	RGD
HuRef	17	4,728,110 - 4,728,728	UniSTS

RH11767

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	4,840,715 - 4,840,837	UniSTS	GRCh37
Build 36	17	4,781,459 - 4,781,582	RGD	NCBI36
Celera	17	4,855,525 - 4,855,648	RGD
Cytogenetic Map	17	p13.3	UniSTS
HuRef	17	4,728,304 - 4,728,427	UniSTS
GeneMap99-GB4 RH Map	17	44.55	UniSTS
NCBI RH Map	17	54.6	UniSTS

SHGC-31613

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	4,840,625 - 4,840,776	UniSTS	GRCh37
Build 36	17	4,781,369 - 4,781,520	RGD	NCBI36
Celera	17	4,855,435 - 4,855,586	RGD
Cytogenetic Map	17	p13.3	UniSTS
HuRef	17	4,728,214 - 4,728,365	UniSTS
Stanford-G3 RH Map	17	295.0	UniSTS
GeneMap99-GB4 RH Map	17	44.55	UniSTS
Whitehead-RH Map	17	43.1	UniSTS
NCBI RH Map	17	77.3	UniSTS
GeneMap99-G3 RH Map	17	295.0	UniSTS

MARC_2889-2890:991933627:9

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	4,841,528 - 4,842,090	UniSTS	GRCh37
Build 36	17	4,782,273 - 4,782,835	RGD	NCBI36
Celera	17	4,856,339 - 4,856,901	RGD
HuRef	17	4,729,118 - 4,729,680	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1204	2432	2788	2245	4942	1723	2345	4	622	1948	464	2268	7281	6454	52	3708	847	1731	1612	171


RefSeq Transcripts	NM_001165417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001165418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_003562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_024450994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA937945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC004771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC109333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF070548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK290376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK313010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC006508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC006519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC016294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC016473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC017170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI752999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM047391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB155476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X66114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000225665 ⟹ ENSP00000225665

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	4,937,130 - 4,940,046 (-)	Ensembl

Ensembl Acc Id:

ENST00000544061 ⟹ ENSP00000440804

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	4,937,724 - 4,940,053 (-)	Ensembl

Ensembl Acc Id:

ENST00000570543

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	4,938,154 - 4,938,557 (-)	Ensembl

Ensembl Acc Id:

ENST00000574710

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	4,937,317 - 4,940,030 (-)	Ensembl

Ensembl Acc Id:

ENST00000576951 ⟹ ENSP00000458993

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	4,937,763 - 4,939,913 (-)	Ensembl

RefSeq Acc Id:

NM_001165417 ⟹ NP_001158889

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	4,937,130 - 4,940,046 (-)	NCBI
GRCh37	17	4,840,425 - 4,843,462 (-)	ENTREZGENE
HuRef	17	4,728,014 - 4,731,052 (-)	ENTREZGENE
CHM1_1	17	4,849,762 - 4,852,800 (-)	NCBI
T2T-CHM13v2.0	17	4,827,477 - 4,830,394 (-)	NCBI

Sequence:

show sequence

GGCTTCCAGCGGGTGTCGGACCTGAGAGCTGGAGGGGCGTGCGCGCGCCCTCGCTCTGTTGCGCGCGCGGTGTCACCTTGGGCGCGAGCGGGGCCGCGCGCGCACGGGACCCGGAGCCGAGGGCCATT
GAGTGGCGATGGCGGCGACGGCGAGTGCCGGGGCCGGCGGGATAGACGGGAAGCCCCGTACCTCCCCTAAGATGGGAGCTACAGTTTTTGTCCAGCCCCTGGACCTGGTGAAGAACCGGATGCAGTTG
AGCGGGGAAGGGGCCAAGACTCGAGAGTACAAAACCAGCTTCCATGCCCTCACCAGTATCCTGAAGGCAGAAGGCCTGAGGGGCATTTACACTGGGCTGTCGGCTGGCCTGCTGCGTCAGGCCACCTA
CACCACTACCCGCCTTGGCATCTATACCGTGCTGTTTGAGCGCCTGACTGGGGCTGATGGTACTCCCCCTGGCTTTCTGCTGAAGGCTGTGATTGGCATGACCGCAGGTGCCACTGGTGCCTTTGTGG
GAACACCAGCCGAAGTGGCTCTTATCCGCATGACTGCCGATGGCCGGCTTCCAGCTGACCAGCGCCGTGGCTACAAAAATGTGTTTAACGCCCTGATTCGAATCACCCGGGAAGAGGGTGTCCTCACA
CTGTGGCGGGGCTGCATCCCTACCATGGCTCGGGCCGTCGTCGTCAATGCTGCCCAGCTCGCCTCCTACTCCCAATCCAAGCAGTTCTTACTGGACTCAGGCTACTTCTCTGACAACATCTTGTGCCA
CTTCTGTGCCAGCATGATCAGCGGTCTTGTCACCACTGCTGCCTCCATGCCTGTGGACATTGCCAAGACCCGAATCCAGAACATGCGGATGATTGATGGGAAGCCGGAATACAAGAACGGGCTGGACG
TGCTGTTCAAAGTTGTCCGCTACGAGGGCTTCTTCAGCCTGTGGAAGGGCTTCACGCCGTACTATGCCCGCCTGGGCCCCCACACCGTCCTCACCTTCATCTTCTTGGAGCAGATGAACAAGGCCTAC
AAGCGTCTCTTCCTCAGTGGCTGAAGCGGCCGGGGGCTCCCACTCGCCTGCTGCGCCTATAGCCACTGCGCCCTGGGGGCCTGGGCTCTGCTGCCCTGGACCCCTCTATTTATTTCCCTTCCACAGTG
TGGTTTCTTCCTCTGCGGTAAAGGACTTGGTCTGTTCTACCCCCTGCTCCAGCTTGCCCTGCTCGTCCTGATCCTGTGATTTCTCTGTCCTTGGCTATTCTTGCAGGGAGCTGGAAAACTTCTGAGGA
TTTCTGGCCTCCCCCTGGGTTTTAGTTTCAGGGCACACAGGACAGCAGAAGATCCCCTTTGTCAGTGGGGAAACCAAGGCAGAGCTGAGGGGACAGGGAGGAGCAGAAGCCATCAAGATGGTCAAAGG
GCCTGCAGAGGGAGATGTGGCCCTTCCTCCCCCTCATTGAGGACTTAATAAATTGGATTGATGACACCAGCCCCAAATCTGGAGAGTCTGGGGGGTGGCTAGGAGAGGGGAGGAGACTGGACAAAGAA
GCTGGAGAATAGGAACTGGAGTTTTTAAGAAAAATTGTTAAAGAAAAAGCAGCCGCTGGTTTTTTGCAAATGCTGTATAAATCTGTCATGCCACAGCAGCTGACAGGGCCAGAAAAACTCAAA

hide sequence

RefSeq Acc Id:

NM_001165418 ⟹ NP_001158890

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	4,937,130 - 4,940,046 (-)	NCBI
GRCh37	17	4,840,425 - 4,843,462 (-)	ENTREZGENE
HuRef	17	4,728,014 - 4,731,052 (-)	ENTREZGENE
CHM1_1	17	4,849,762 - 4,852,800 (-)	NCBI
T2T-CHM13v2.0	17	4,827,477 - 4,830,394 (-)	NCBI

Sequence:

show sequence

GGCTTCCAGCGGGTGTCGGACCTGAGAGCTGGAGGGGCGTGCGCGCGCCCTCGCTCTGTTGCGCGCGCGGTGTCACCTTGGGCGCGAGCGGGGCCGCGCGCGCACGGGACCCGGAGCCGAGGGCCATT
GAGTGGCGATGGCGGCGACGGCGAGTGCCGGGGCCGGCGGGATAGACGGGAAGCCCCGTACCTCCCCTAAGTCCGTCAAGTTCCTGTTTGGGGGCCTGGCCGGGCTGTCGGCTGGCCTGCTGCGTCAG
GCCACCTACACCACTACCCGCCTTGGCATCTATACCGTGCTGTTTGAGCGCCTGACTGGGGCTGATGGTACTCCCCCTGGCTTTCTGCTGAAGGCTGTGATTGGCATGACCGCAGGTGCCACTGGTGC
CTTTGTGGGAACACCAGCCGAAGTGGCTCTTATCCGCATGACTGCCGATGGCCGGCTTCCAGCTGACCAGCGCCGTGGCTACAAAAATGTGTTTAACGCCCTGATTCGAATCACCCGGGAAGAGGGTG
TCCTCACACTGTGGCGGGGCTGCATCCCTACCATGGCTCGGGCCGTCGTCGTCAATGCTGCCCAGCTCGCCTCCTACTCCCAATCCAAGCAGTTCTTACTGGACTCAGGCTACTTCTCTGACAACATC
TTGTGCCACTTCTGTGCCAGCATGATCAGCGGTCTTGTCACCACTGCTGCCTCCATGCCTGTGGACATTGCCAAGACCCGAATCCAGAACATGCGGATGATTGATGGGAAGCCGGAATACAAGAACGG
GCTGGACGTGCTGTTCAAAGTTGTCCGCTACGAGGGCTTCTTCAGCCTGTGGAAGGGCTTCACGCCGTACTATGCCCGCCTGGGCCCCCACACCGTCCTCACCTTCATCTTCTTGGAGCAGATGAACA
AGGCCTACAAGCGTCTCTTCCTCAGTGGCTGAAGCGGCCGGGGGCTCCCACTCGCCTGCTGCGCCTATAGCCACTGCGCCCTGGGGGCCTGGGCTCTGCTGCCCTGGACCCCTCTATTTATTTCCCTT
CCACAGTGTGGTTTCTTCCTCTGCGGTAAAGGACTTGGTCTGTTCTACCCCCTGCTCCAGCTTGCCCTGCTCGTCCTGATCCTGTGATTTCTCTGTCCTTGGCTATTCTTGCAGGGAGCTGGAAAACT
TCTGAGGATTTCTGGCCTCCCCCTGGGTTTTAGTTTCAGGGCACACAGGACAGCAGAAGATCCCCTTTGTCAGTGGGGAAACCAAGGCAGAGCTGAGGGGACAGGGAGGAGCAGAAGCCATCAAGATG
GTCAAAGGGCCTGCAGAGGGAGATGTGGCCCTTCCTCCCCCTCATTGAGGACTTAATAAATTGGATTGATGACACCAGCCCCAAATCTGGAGAGTCTGGGGGGTGGCTAGGAGAGGGGAGGAGACTGG
ACAAAGAAGCTGGAGAATAGGAACTGGAGTTTTTAAGAAAAATTGTTAAAGAAAAAGCAGCCGCTGGTTTTTTGCAAATGCTGTATAAATCTGTCATGCCACAGCAGCTGACAGGGCCAGAAAAACTC
AAA

hide sequence

RefSeq Acc Id:

NM_003562 ⟹ NP_003553

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	4,937,130 - 4,940,046 (-)	NCBI
GRCh37	17	4,840,425 - 4,843,462 (-)	ENTREZGENE
Build 36	17	4,781,349 - 4,784,063 (-)	NCBI Archive
HuRef	17	4,728,014 - 4,731,052 (-)	ENTREZGENE
CHM1_1	17	4,849,762 - 4,852,800 (-)	NCBI
T2T-CHM13v2.0	17	4,827,477 - 4,830,394 (-)	NCBI

Sequence:

show sequence

GGCTTCCAGCGGGTGTCGGACCTGAGAGCTGGAGGGGCGTGCGCGCGCCCTCGCTCTGTTGCGC
GCGCGGTGTCACCTTGGGCGCGAGCGGGGCCGCGCGCGCACGGGACCCGGAGCCGAGGGCCATTGAGTGGCGATGGCGGCGACGGCGAGTGCCGGGGCCGGCGGGATAGACGGGAAGCCCCGTACCTC
CCCTAAGTCCGTCAAGTTCCTGTTTGGGGGCCTGGCCGGGATGGGAGCTACAGTTTTTGTCCAGCCCCTGGACCTGGTGAAGAACCGGATGCAGTTGAGCGGGGAAGGGGCCAAGACTCGAGAGTACA
AAACCAGCTTCCATGCCCTCACCAGTATCCTGAAGGCAGAAGGCCTGAGGGGCATTTACACTGGGCTGTCGGCTGGCCTGCTGCGTCAGGCCACCTACACCACTACCCGCCTTGGCATCTATACCGTG
CTGTTTGAGCGCCTGACTGGGGCTGATGGTACTCCCCCTGGCTTTCTGCTGAAGGCTGTGATTGGCATGACCGCAGGTGCCACTGGTGCCTTTGTGGGAACACCAGCCGAAGTGGCTCTTATCCGCAT
GACTGCCGATGGCCGGCTTCCAGCTGACCAGCGCCGTGGCTACAAAAATGTGTTTAACGCCCTGATTCGAATCACCCGGGAAGAGGGTGTCCTCACACTGTGGCGGGGCTGCATCCCTACCATGGCTC
GGGCCGTCGTCGTCAATGCTGCCCAGCTCGCCTCCTACTCCCAATCCAAGCAGTTCTTACTGGACTCAGGCTACTTCTCTGACAACATCTTGTGCCACTTCTGTGCCAGCATGATCAGCGGTCTTGTC
ACCACTGCTGCCTCCATGCCTGTGGACATTGCCAAGACCCGAATCCAGAACATGCGGATGATTGATGGGAAGCCGGAATACAAGAACGGGCTGGACGTGCTGTTCAAAGTTGTCCGCTACGAGGGCTT
CTTCAGCCTGTGGAAGGGCTTCACGCCGTACTATGCCCGCCTGGGCCCCCACACCGTCCTCACCTTCATCTTCTTGGAGCAGATGAACAAGGCCTACAAGCGTCTCTTCCTCAGTGGCTGAAGCGGCC
GGGGGCTCCCACTCGCCTGCTGCGCCTATAGCCACTGCGCCCTGGGGGCCTGGGCTCTGCTGCCCTGGACCCCTCTATTTATTTCCCTTCCACAGTGTGGTTTCTTCCTCTGCGGTAAAGGACTTGGT
CTGTTCTACCCCCTGCTCCAGCTTGCCCTGCTCGTCCTGATCCTGTGATTTCTCTGTCCTTGGCTATTCTTGCAGGGAGCTGGAAAACTTCTGAGGATTTCTGGCCTCCCCCTGGGTTTTAGTTTCAG
GGCACACAGGACAGCAGAAGATCCCCTTTGTCAGTGGGGAAACCAAGGCAGAGCTGAGGGGACAGGGAGGAGCAGAAGCCATCAAGATGGTCAAAGGGCCTGCAGAGGGAGATGTGGCCCTTCCTCCC
CCTCATTGAGGACTTAATAAATTGGATTGATGACACCAGCCCCAAATCTGGAGAGTCTGGGGGGTGGCTAGGAGAGGGGAGGAGACTGGACAAAGAAGCTGGAGAATAGGAACTGGAGTTTTTAAGAA
AAATTGTTAAAGAAAAAGCAGCCGCTGGTTTTTTGCAAATGCTGTATAAATCTGTCATGCCACAGCAGCTGACAGGGCCAGAAAAACTCAAA

hide sequence


Protein RefSeqs	NP_001158889	(Get FASTA)	NCBI Sequence Viewer
	NP_001158890	(Get FASTA)	NCBI Sequence Viewer
	NP_003553	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC28637	(Get FASTA)	NCBI Sequence Viewer
	AAH06508	(Get FASTA)	NCBI Sequence Viewer
	AAH06519	(Get FASTA)	NCBI Sequence Viewer
	AAH16294	(Get FASTA)	NCBI Sequence Viewer
	AAH17170	(Get FASTA)	NCBI Sequence Viewer
	BAF83065	(Get FASTA)	NCBI Sequence Viewer
	CAA46905	(Get FASTA)	NCBI Sequence Viewer
	CAG33115	(Get FASTA)	NCBI Sequence Viewer
	EAW90389	(Get FASTA)	NCBI Sequence Viewer
	EAW90390	(Get FASTA)	NCBI Sequence Viewer
	EAW90391	(Get FASTA)	NCBI Sequence Viewer
	EAW90392	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000225665
	ENSP00000225665.7
	ENSP00000440804
	ENSP00000440804.2
	ENSP00000458993
GenBank Protein	Q02978	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001158889 ⟸ NM_001165417
- Peptide Label:	isoform 2
- UniProtKB:	I3L1P8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAATASAGAGGIDGKPRTSPKMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTP AEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLF KVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG hide sequence

RefSeq Acc Id:	NP_001158890 ⟸ NM_001165418
- Peptide Label:	isoform 3
- UniProtKB:	I3L1P8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGLSAGLLRQATYTTTRLGIYTVLFERLTGADGT PPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIA KTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG hide sequence

RefSeq Acc Id:	NP_003553 ⟸ NM_003562
- Peptide Label:	isoform 1
- UniProtKB:	O75537 (UniProtKB/Swiss-Prot), F5GY65 (UniProtKB/Swiss-Prot), Q969P7 (UniProtKB/Swiss-Prot), Q02978 (UniProtKB/Swiss-Prot), Q6IBH0 (UniProtKB/TrEMBL), I3L1P8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMT AGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGK PEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG hide sequence

Ensembl Acc Id:

ENSP00000440804 ⟸ ENST00000544061

Ensembl Acc Id:

ENSP00000458993 ⟸ ENST00000576951

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q02978-F1-model_v2	AlphaFold	Q02978	1-314	view protein structure

RGD ID:

6794539

Promoter ID:

HG_KWN:24759

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

NM_001165417, NM_001165418, OTTHUMT00000216852, UC002FZP.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	17	4,783,361 - 4,785,102 (-)	MPROMDB

RGD ID:

7233479

Promoter ID:

EPDNEW_H22485

Type:

initiation region

Name:

SLC25A11_1

Description:

solute carrier family 25 member 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	4,940,046 - 4,940,106	EPDNEW

Database	Acc Id	Source(s)
COSMIC	SLC25A11	COSMIC
Ensembl Genes	ENSG00000108528	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000225665	ENTREZGENE
	ENST00000225665.12	UniProtKB/Swiss-Prot
	ENST00000544061	ENTREZGENE
	ENST00000544061.6	UniProtKB/Swiss-Prot
	ENST00000576951	ENTREZGENE
Gene3D-CATH	1.50.40.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000108528	GTEx
HGNC ID	HGNC:10981	ENTREZGENE
Human Proteome Map	SLC25A11	Human Proteome Map
InterPro	Mito_Metabolite_Transporter	UniProtKB/Swiss-Prot
	Mitochondrial_sb/sol_carrier	UniProtKB/Swiss-Prot
	Mt_carrier_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:8402	UniProtKB/Swiss-Prot
NCBI Gene	8402	ENTREZGENE
OMIM	604165	OMIM
PANTHER	MITOCHONDRIAL DICARBOXYLATE CARRIER-RELATED	UniProtKB/Swiss-Prot
Pfam	Mito_carr	UniProtKB/Swiss-Prot
PharmGKB	PA35857	PharmGKB
PROSITE	SOLCAR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF103506	UniProtKB/Swiss-Prot
UniProt	F5GY65	ENTREZGENE
	I3L1P8	ENTREZGENE, UniProtKB/TrEMBL
	M2OM_HUMAN	UniProtKB/Swiss-Prot
	O75537	ENTREZGENE
	Q02978	ENTREZGENE
	Q6IBH0	ENTREZGENE, UniProtKB/TrEMBL
	Q969P7	ENTREZGENE
UniProt Secondary	F5GY65	UniProtKB/Swiss-Prot
	O75537	UniProtKB/Swiss-Prot
	Q969P7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-23	SLC25A11	solute carrier family 25 member 11		solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Human Phenotype Annotations - HPO

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Human Phenotype Annotations - HPO