Symbol:
Smyd2
Name:
SET and MYND domain containing 2
RGD ID:
727785
Description:
Predicted to enable RNA polymerase II complex binding activity; histone H3K36 methyltransferase activity; and p53 binding activity. Involved in heart development. Predicted to be located in cytosol. Predicted to be active in nucleus. Orthologous to human SMYD2 (SET and MYND domain containing 2); PARTICIPATES IN histone modification pathway; methionine cycle/metabolic pathway; p53 signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; atrazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
histone methyltransferase SMYD2; HSKM-B; N-lysine methyltransferase SMYD2; SET and MYND domain-containing protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SMYD2 (SET and MYND domain containing 2)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Smyd2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Smyd2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SMYD2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SMYD2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Smyd2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SMYD2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SMYD2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Smyd2 (SET and MYND domain containing 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SMYD2 (SET and MYND domain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Smyd2 (SET and MYND domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
smyd2a (SET and MYND domain containing 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Smyd3
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
set-14
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SET6
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
set-30
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 103,956,470 - 103,997,774 (-) NCBI GRCr8 mRatBN7.2 13 101,425,270 - 101,466,576 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 101,425,273 - 101,466,576 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 103,940,656 - 103,981,564 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 105,329,429 - 105,370,669 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 102,534,981 - 102,578,302 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 108,642,156 - 108,686,293 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 108,642,156 - 108,686,290 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 113,261,746 - 113,302,399 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 106,160,147 - 106,201,473 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 106,349,462 - 106,390,567 (-) NCBI Celera 13 100,910,865 - 100,950,701 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Smyd2 Rat 1,2-dimethylhydrazine increases expression ISO Smyd2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA CTD PMID:22206623 Smyd2 Rat 1,2-dimethylhydrazine multiple interactions ISO Smyd2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA] CTD PMID:22206623 Smyd2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SMYD2 mRNA CTD PMID:26496021 Smyd2 Rat 17beta-estradiol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Estradiol results in decreased expression of SMYD2 mRNA CTD PMID:32030086 Smyd2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SMYD2 mRNA CTD PMID:32145629 Smyd2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMYD2 mRNA CTD PMID:21215274 Smyd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SMYD2 mRNA CTD PMID:33387578 Smyd2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Smyd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SMYD2 mRNA CTD PMID:21570461 Smyd2 Rat 5-aza-2'-deoxycytidine decreases methylation ISO Smyd2 (Mus musculus) 6480464 Decitabine results in decreased methylation of SMYD2 gene CTD PMID:27923600 Smyd2 Rat acrylamide decreases expression ISO SMYD2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SMYD2 mRNA CTD PMID:32763439 Smyd2 Rat all-trans-retinoic acid increases expression ISO SMYD2 (Homo sapiens) 6480464 Tretinoin results in increased expression of SMYD2 mRNA CTD PMID:21934132 Smyd2 Rat all-trans-retinoic acid decreases expression ISO SMYD2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SMYD2 mRNA CTD PMID:33167477 Smyd2 Rat antirheumatic drug increases expression ISO SMYD2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SMYD2 mRNA CTD PMID:24449571 Smyd2 Rat aristolochic acid A decreases expression ISO SMYD2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SMYD2 mRNA CTD PMID:33212167 Smyd2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of SMYD2 gene CTD PMID:35440735 Smyd2 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SMYD2 mRNA CTD PMID:21839799 Smyd2 Rat bis(2-ethylhexyl) phthalate increases expression ISO SMYD2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SMYD2 mRNA CTD PMID:31163220 Smyd2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SMYD2 mRNA CTD PMID:26496021 Smyd2 Rat bisphenol A decreases expression ISO SMYD2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SMYD2 mRNA CTD PMID:29275510 and PMID:32030086 Smyd2 Rat bisphenol A affects expression ISO SMYD2 (Homo sapiens) 6480464 bisphenol A affects the expression of SMYD2 mRNA CTD PMID:30903817 Smyd2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SMYD2 mRNA CTD PMID:25181051 more ... Smyd2 Rat cadmium dichloride decreases expression ISO SMYD2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SMYD2 mRNA CTD PMID:38568856 Smyd2 Rat cantharidin decreases expression ISO Smyd2 (Mus musculus) 6480464 Cantharidin results in decreased expression of SMYD2 mRNA CTD PMID:36907384 Smyd2 Rat carbamazepine affects expression ISO SMYD2 (Homo sapiens) 6480464 Carbamazepine affects the expression of SMYD2 mRNA CTD PMID:25979313 Smyd2 Rat carbon nanotube decreases expression ISO Smyd2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of SMYD2 mRNA CTD PMID:25620056 Smyd2 Rat carbon nanotube increases expression ISO Smyd2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SMYD2 mRNA CTD PMID:25554681 Smyd2 Rat CGP 52608 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SMYD2 gene] CTD PMID:28238834 Smyd2 Rat cobalt dichloride decreases expression ISO SMYD2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SMYD2 mRNA CTD PMID:19320972 Smyd2 Rat copper(II) sulfate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SMYD2 mRNA CTD PMID:19549813 Smyd2 Rat coumestrol multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMYD2 mRNA CTD PMID:19167446 Smyd2 Rat cyclosporin A decreases expression ISO SMYD2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SMYD2 mRNA CTD PMID:25562108 and PMID:27989131 Smyd2 Rat dicrotophos decreases expression ISO SMYD2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SMYD2 mRNA CTD PMID:28302478 Smyd2 Rat dioxygen multiple interactions ISO Smyd2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SMYD2 mRNA CTD PMID:30529165 Smyd2 Rat dorsomorphin multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smyd2 Rat doxorubicin decreases expression ISO SMYD2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SMYD2 mRNA CTD PMID:29803840 Smyd2 Rat Enterolactone multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMYD2 mRNA CTD PMID:19167446 Smyd2 Rat ethanol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ethanol results in decreased expression of SMYD2 mRNA CTD PMID:35149083 Smyd2 Rat ethyl methanesulfonate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SMYD2 mRNA CTD PMID:23649840 Smyd2 Rat fenthion increases expression ISO Smyd2 (Mus musculus) 6480464 Fenthion results in increased expression of SMYD2 mRNA CTD PMID:34813904 Smyd2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SMYD2 mRNA CTD PMID:24136188 Smyd2 Rat folic acid multiple interactions ISO Smyd2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA] CTD PMID:22206623 Smyd2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SMYD2 mRNA CTD PMID:22061828 Smyd2 Rat ivermectin decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SMYD2 protein CTD PMID:32959892 Smyd2 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of SMYD2 mRNA CTD PMID:24136188 Smyd2 Rat levonorgestrel multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of SMYD2 mRNA CTD PMID:19074003 Smyd2 Rat lipopolysaccharide multiple interactions ISO Smyd2 (Mus musculus) 6480464 [SMYD2 mRNA affects the susceptibility to [Lipopolysaccharides co-treated with IFNG protein]] which results in decreased expression of IL6 mRNA more ... CTD PMID:29718165 Smyd2 Rat LLY-507 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 LLY-507 binds to and results in decreased activity of SMYD2 protein CTD PMID:25825497 Smyd2 Rat menadione affects expression ISO SMYD2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SMYD2 mRNA CTD PMID:20044591 Smyd2 Rat methidathion increases expression ISO Smyd2 (Mus musculus) 6480464 methidathion results in increased expression of SMYD2 mRNA CTD PMID:34813904 Smyd2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SMYD2 gene CTD PMID:35440735 Smyd2 Rat methyl methanesulfonate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SMYD2 mRNA CTD PMID:23649840 Smyd2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SMYD2 gene CTD PMID:33148267 Smyd2 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SMYD2 mRNA CTD PMID:28801915 Smyd2 Rat panobinostat multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Rat panobinostat increases expression ISO SMYD2 (Homo sapiens) 6480464 panobinostat results in increased expression of SMYD2 mRNA CTD PMID:26272509 Smyd2 Rat paracetamol affects expression ISO Smyd2 (Mus musculus) 6480464 Acetaminophen affects the expression of SMYD2 mRNA CTD PMID:17562736 Smyd2 Rat paracetamol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SMYD2 mRNA CTD PMID:21420995 Smyd2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SMYD2 mRNA CTD PMID:32680482 Smyd2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SMYD2 gene CTD PMID:33148267 Smyd2 Rat phenobarbital affects expression ISO SMYD2 (Homo sapiens) 6480464 Phenobarbital affects the expression of SMYD2 mRNA CTD PMID:19159669 Smyd2 Rat phenylmercury acetate increases expression ISO SMYD2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SMYD2 mRNA CTD PMID:26272509 Smyd2 Rat phenylmercury acetate multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Rat pirinixic acid increases expression ISO Smyd2 (Mus musculus) 6480464 pirinixic acid results in increased expression of SMYD2 mRNA CTD PMID:23811191 Smyd2 Rat S-adenosyl-L-methioninate affects binding ISO SMYD2 (Homo sapiens) 6480464 S-Adenosylmethionine binds to SMYD2 protein CTD PMID:21782458 Smyd2 Rat S-adenosyl-L-methionine affects binding ISO SMYD2 (Homo sapiens) 6480464 S-Adenosylmethionine binds to SMYD2 protein CTD PMID:21782458 Smyd2 Rat SB 431542 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smyd2 Rat sodium arsenite decreases expression ISO SMYD2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SMYD2 mRNA CTD PMID:38568856 Smyd2 Rat testosterone undecanoate multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of SMYD2 mRNA CTD PMID:19074003 Smyd2 Rat tetrachloromethane increases expression ISO Smyd2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SMYD2 mRNA CTD PMID:31919559 Smyd2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SMYD2 mRNA CTD PMID:23411599 and PMID:34492290 Smyd2 Rat titanium dioxide increases methylation ISO Smyd2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SMYD2 gene CTD PMID:35295148 Smyd2 Rat trichostatin A increases expression ISO SMYD2 (Homo sapiens) 6480464 trichostatin A results in increased expression of SMYD2 mRNA CTD PMID:24935251 and PMID:26272509 Smyd2 Rat trichostatin A multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Rat triphenyl phosphate affects expression ISO SMYD2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SMYD2 mRNA CTD PMID:37042841 Smyd2 Rat triptonide affects expression ISO Smyd2 (Mus musculus) 6480464 triptonide affects the expression of SMYD2 mRNA CTD PMID:33045310 Smyd2 Rat valproic acid affects expression ISO Smyd2 (Mus musculus) 6480464 Valproic Acid affects the expression of SMYD2 mRNA CTD PMID:17292431 Smyd2 Rat valproic acid multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Rat valproic acid decreases expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SMYD2 mRNA CTD PMID:23179753 more ... Smyd2 Rat valproic acid increases expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SMYD2 mRNA CTD PMID:23179753 more ... Smyd2 Rat valproic acid affects expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SMYD2 mRNA CTD PMID:25979313 Smyd2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SMYD2 mRNA CTD PMID:22570695 Smyd2 Rat vitamin E decreases expression ISO SMYD2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of SMYD2 mRNA CTD PMID:19244175 Smyd2 Rat zinc atom decreases expression ISO SMYD2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SMYD2 mRNA CTD PMID:22171008 Smyd2 Rat zinc(0) decreases expression ISO SMYD2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SMYD2 mRNA CTD PMID:22171008
Imported Annotations - PID (archival)
1.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
2.
Dysregulation of CREB binding protein triggers thrombin-induced proliferation of vascular smooth muscle cells.
Chen J, etal., Mol Cell Biochem. 2008 Aug;315(1-2):123-30. Epub 2008 May 23.
3.
Cardiac deletion of Smyd2 is dispensable for mouse heart development.
Diehl F, etal., PLoS One. 2010 Mar 17;5(3):e9748. doi: 10.1371/journal.pone.0009748.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Targeting protein lysine methylation and demethylation in cancers.
He Y, etal., Acta Biochim Biophys Sin (Shanghai). 2012 Jan;44(1):70-9. doi: 10.1093/abbs/gmr109.
6.
Modes of p53 regulation.
Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
7.
NCBI rat LocusLink and RefSeq merged data October 15, 2003
NCBI rat LocusLink and RefSeq merged data October 15, 2003
8.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Lysine methyltransferase Smyd2 regulates Hsp90-mediated protection of the sarcomeric titin springs and cardiac function.
Voelkel T, etal., Biochim Biophys Acta. 2013 Apr;1833(4):812-22. doi: 10.1016/j.bbamcr.2012.09.012. Epub 2012 Oct 6.
Smyd2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 103,956,470 - 103,997,774 (-) NCBI GRCr8 mRatBN7.2 13 101,425,270 - 101,466,576 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 101,425,273 - 101,466,576 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 103,940,656 - 103,981,564 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 105,329,429 - 105,370,669 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 102,534,981 - 102,578,302 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 108,642,156 - 108,686,293 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 108,642,156 - 108,686,290 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 113,261,746 - 113,302,399 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 106,160,147 - 106,201,473 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 106,349,462 - 106,390,567 (-) NCBI Celera 13 100,910,865 - 100,950,701 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
SMYD2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 214,281,159 - 214,337,131 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 214,281,102 - 214,337,131 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 214,454,502 - 214,510,474 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 212,521,199 - 212,577,097 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 210,842,970 - 210,898,868 NCBI Celera 1 187,677,508 - 187,733,362 (+) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 185,129,703 - 185,185,600 (+) NCBI HuRef CHM1_1 1 215,726,941 - 215,782,851 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 213,520,680 - 213,576,627 (+) NCBI T2T-CHM13v2.0
Smyd2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 189,612,689 - 189,654,758 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 189,612,689 - 189,654,560 (-) Ensembl GRCm39 Ensembl GRCm38 1 189,880,492 - 189,922,495 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 189,880,492 - 189,922,363 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 191,704,371 - 191,746,167 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 191,581,280 - 191,623,076 (-) NCBI MGSCv36 mm8 Celera 1 196,790,858 - 196,832,656 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 95.03 NCBI
Smyd2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 3,465,924 - 3,509,156 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 3,467,123 - 3,509,156 (-) NCBI ChiLan1.0 ChiLan1.0
SMYD2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 35,065,100 - 35,121,132 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 35,029,402 - 35,085,432 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 189,849,167 - 189,905,193 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 194,729,116 - 194,761,043 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 194,729,116 - 194,761,045 (+) Ensembl panpan1.1 panPan2
SMYD2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 12,281,581 - 12,331,294 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 12,281,710 - 12,331,164 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 11,855,760 - 11,905,351 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 11,991,481 - 12,041,301 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 11,991,446 - 12,044,237 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 11,915,043 - 11,964,795 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 12,019,583 - 12,068,986 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 12,143,792 - 12,193,251 (+) NCBI UU_Cfam_GSD_1.0
Smyd2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 61,907,871 - 61,955,361 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936628 3,918,230 - 3,965,387 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936628 3,917,898 - 3,965,382 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMYD2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 129,263,526 - 129,316,349 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 129,263,524 - 129,316,226 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 142,158,967 - 142,212,600 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMYD2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 15,236,773 - 15,293,154 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 15,235,653 - 15,293,153 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 15,711,719 - 15,767,873 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smyd2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 173 Count of miRNA genes: 123 Interacting mature miRNAs: 133 Transcripts: ENSRNOT00000004783 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat
RH130282
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 101,425,352 - 101,425,540 (-) MAPPER mRatBN7.2 Rnor_6.0 13 108,686,023 - 108,686,210 NCBI Rnor6.0 Rnor_5.0 13 113,302,129 - 113,302,316 UniSTS Rnor5.0 RGSC_v3.4 13 106,160,230 - 106,160,417 UniSTS RGSC3.4 Celera 13 100,910,948 - 100,911,135 UniSTS RH 3.4 Map 13 697.9 UniSTS Cytogenetic Map 13 q27 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004783 ⟹ ENSRNOP00000004783
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 101,425,273 - 101,466,576 (-) Ensembl Rnor_6.0 Ensembl 13 108,642,156 - 108,686,290 (+) Ensembl
RefSeq Acc Id:
NM_206851 ⟹ NP_996733
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 103,956,470 - 103,997,774 (-) NCBI mRatBN7.2 13 101,425,270 - 101,466,576 (-) NCBI Rnor_6.0 13 108,642,156 - 108,686,293 (+) NCBI Rnor_5.0 13 113,261,746 - 113,302,399 (+) NCBI RGSC_v3.4 13 106,160,147 - 106,201,473 (-) RGD Celera 13 100,910,865 - 100,950,701 (-) RGD
Sequence:
GTGCCCCGCAGCGCGCAGCCGCAGCGCTGCCAGCATGCGCGCCGAGGCCCGCGGCGGCCTGGAGCGCTTCTGCAGCGCGGGCAAGGGCCGGGGGCTCCGTGCGCTGCGGCCCTTCCACGTGGGCGACC TCCTCTTCTCCTGCCCGGCCTACGCCTGCGTGCTCACCGTGGGCGAGCGGGGCCACCACTGCGAGTGCTGCTTCGCCAGGAAAGAAGGATTGTCGAAATGTGGACGATGCAAGCAAGCCTTCTACTGC GATGTGGAGTGTCAGAAAGAAGACTGGCCCCTGCACAAGCTGGAGTGCTCCTCCATGGTTGTTTTCGGGGAGAACTGGAATCCCTCGGAGACTGTGCGGCTCACAGCAAGGATCCTGGCCAAGCAGAA AATGCACCCAGAGAGGACACCTTCAGAGAAACTGTTGGCCGTGAGGGAGTTTGAGTCACATCTGGACAAGCTAGACAACGAGAAGAAGGATCTCATCCAGAGCGACATCGCGGCGCTCCATCAGTTCT ACTCCAAGCACCTGGAGTTCCCTGACCACAGCAGCCTTGTGGTGCTCTTTGCCCAGGTGAACTGTAATGGCTTCACTATTGAAGATGAGGAGCTCTCTCACTTGGGATCGGCGATATTTCCTGATGTT GCGCTGATGAATCACAGCTGCTGCCCGAATGTCATTGTGACCTACAAAGGTACCCTGGCAGAAGTCAGAGCTGTGCAGGAGATCCACCCAGGAGATGAGGTGTTCACCAGCTATATCGACCTGCTGTA TCCAACAGAAGACAGGAACGACCGGTTAAGAGACTCCTACTTCTTTACCTGTGAGTGCCGGGAGTGTACGACCAAGGACAAGGACAAGGCCAAGGTGGAAATCCGGAAGCTCAGCAACCCACCTCAGG CAGAAGCCATCCGAGACATGGTCAGATACGCACGCAATGTCATCGAGGAGTTCCGGAGGGCCAAGCACTACAAATCCCCTAGTGAGCTGTTGGAAATCTGTGAGCTCAGCCAGGAGAAGATGAGCTCT GTGTTTGAGGACAGCAATGTGTACATGCTACACATGATGTACCAGGCCATGGGCGTCTGCCTGTACATGCAGGACTGGGAAGGAGCCCTGAAATATGGCCAGAAGATCATCAAACCCTACAGTAAGCA CTACCCCGTGTACTCCCTCAACGTGGCCTCCATGTGGCTGAAGTTGGGAAGACTGTACATGGGCCTGGAGAACAAAGCTGCCGGGGAGAAGGCCCTGAAGAAGGCCATCGCCATCATGGAAATAGCTC ATGGCAAGGACCACCCGTACATCTCCGAGATCAAGCAGGAAATTGAGAGCCACTGACCATGCGTCCCAGCTTTCCGTCAGAAACCTCACAGTCACCCCAGCCTTCTGCAAGCCTCGCCATGCTGTGTT CCAGTTCGCATTTCCAGTGCTTGCCTGTGCTCTAAGGGCCGTGGCATGATTTCACATAATACATATTTTGGGCAGATTGAGCTTTAAAAAATGCAACCATTTTCCCTCTGTGCCTGTCGGAATGCTCT GCAGAGCTGACCGAGGAGAGAATAAAAGCGCCAGTCCTTAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_996733 ⟸ NM_206851
- UniProtKB:
Q7M6Z3 (UniProtKB/Swiss-Prot)
- Sequence:
MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVFGENWNPSETVRLTARILAKQKMHPERTPSEKL LAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRD SYFFTCECRECTTKDKDKAKVEIRKLSNPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASM WLKLGRLYMGLENKAAGEKALKKAIAIMEIAHGKDHPYISEIKQEIESH
hide sequence
Ensembl Acc Id:
ENSRNOP00000004783 ⟸ ENSRNOT00000004783
RGD ID: 13699106
Promoter ID: EPDNEW_R9631
Type: initiation region
Name: Smyd2_1
Description: SET and MYND domain containing 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 108,642,172 - 108,642,232 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Smyd2
SET and MYND domain containing 2
Symbol and Name status set to approved
1299863
APPROVED