Symbol:
Smyd2
Name:
SET and MYND domain containing 2
RGD ID:
1552013
MGI Page
MGI
Description:
Enables RNA polymerase II complex binding activity and histone H3K36 methyltransferase activity. Involved in negative regulation of cell population proliferation and peptidyl-lysine dimethylation. Located in cytosol and nucleus. Is expressed in several structures, including gonad; heart; hemolymphoid system gland; nasal cavity epithelium; and nervous system. Orthologous to human SMYD2 (SET and MYND domain containing 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110020E07Rik; 4930402C15; histone methyltransferase SMYD2; KMT3C; N-lysine methyltransferase SMYD2; SET and MYND domain-containing protein 2; Zmynd1; Zmynd14
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SMYD2 (SET and MYND domain containing 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Smyd2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Smyd2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SMYD2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SMYD2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Smyd2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SMYD2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SMYD2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Smyd2 (SET and MYND domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Smyd2 (SET and MYND domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SMYD2 (SET and MYND domain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
smyd2a (SET and MYND domain containing 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
smyd2b (SET and MYND domain containing 2b)
Alliance
DIOPT (PANTHER|ZFIN)
Drosophila melanogaster (fruit fly):
Smyd3
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
set-14
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
set-18
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|PANTHER|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 189,612,689 - 189,654,758 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 189,612,689 - 189,654,560 (-) Ensembl GRCm39 Ensembl GRCm38 1 189,880,492 - 189,922,495 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 189,880,492 - 189,922,363 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 191,704,371 - 191,746,167 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 191,581,280 - 191,623,076 (-) NCBI MGSCv36 mm8 Celera 1 196,790,858 - 196,832,656 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 95.03 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Smyd2 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA] CTD PMID:22206623 Smyd2 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA CTD PMID:22206623 Smyd2 Mouse 17beta-estradiol multiple interactions ISO Smyd2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SMYD2 mRNA CTD PMID:26496021 Smyd2 Mouse 17beta-estradiol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Estradiol results in decreased expression of SMYD2 mRNA CTD PMID:32030086 Smyd2 Mouse 17beta-estradiol decreases expression ISO Smyd2 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of SMYD2 mRNA CTD PMID:32145629 Smyd2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Smyd2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMYD2 mRNA CTD PMID:21215274 Smyd2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SMYD2 mRNA CTD PMID:33387578 Smyd2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SMYD2 mRNA CTD PMID:21570461 Smyd2 Mouse 5-aza-2'-deoxycytidine decreases methylation EXP 6480464 Decitabine results in decreased methylation of SMYD2 gene CTD PMID:27923600 Smyd2 Mouse acrylamide decreases expression ISO SMYD2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SMYD2 mRNA CTD PMID:32763439 Smyd2 Mouse all-trans-retinoic acid increases expression ISO SMYD2 (Homo sapiens) 6480464 Tretinoin results in increased expression of SMYD2 mRNA CTD PMID:21934132 Smyd2 Mouse all-trans-retinoic acid decreases expression ISO SMYD2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SMYD2 mRNA CTD PMID:33167477 Smyd2 Mouse antirheumatic drug increases expression ISO SMYD2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SMYD2 mRNA CTD PMID:24449571 Smyd2 Mouse aristolochic acid A decreases expression ISO SMYD2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SMYD2 mRNA CTD PMID:33212167 Smyd2 Mouse atrazine affects methylation ISO Smyd2 (Rattus norvegicus) 6480464 Atrazine affects the methylation of SMYD2 gene CTD PMID:35440735 Smyd2 Mouse benzo[a]pyrene increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in increased expression of SMYD2 mRNA CTD PMID:21839799 Smyd2 Mouse bis(2-ethylhexyl) phthalate increases expression ISO SMYD2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SMYD2 mRNA CTD PMID:31163220 Smyd2 Mouse bisphenol A multiple interactions ISO Smyd2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SMYD2 mRNA CTD PMID:26496021 Smyd2 Mouse bisphenol A affects expression ISO SMYD2 (Homo sapiens) 6480464 bisphenol A affects the expression of SMYD2 mRNA CTD PMID:30903817 Smyd2 Mouse bisphenol A decreases expression ISO SMYD2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SMYD2 mRNA CTD PMID:29275510 and PMID:32030086 Smyd2 Mouse bisphenol A decreases expression ISO Smyd2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SMYD2 mRNA CTD PMID:25181051 more ... Smyd2 Mouse cadmium dichloride decreases expression ISO SMYD2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SMYD2 mRNA CTD PMID:38568856 Smyd2 Mouse cantharidin decreases expression EXP 6480464 Cantharidin results in decreased expression of SMYD2 mRNA CTD PMID:36907384 Smyd2 Mouse carbamazepine affects expression ISO SMYD2 (Homo sapiens) 6480464 Carbamazepine affects the expression of SMYD2 mRNA CTD PMID:25979313 Smyd2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of SMYD2 mRNA CTD PMID:25620056 Smyd2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of SMYD2 mRNA CTD PMID:25554681 Smyd2 Mouse CGP 52608 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SMYD2 gene] CTD PMID:28238834 Smyd2 Mouse cobalt dichloride decreases expression ISO SMYD2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SMYD2 mRNA CTD PMID:19320972 Smyd2 Mouse copper(II) sulfate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SMYD2 mRNA CTD PMID:19549813 Smyd2 Mouse coumestrol multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMYD2 mRNA CTD PMID:19167446 Smyd2 Mouse cyclosporin A decreases expression ISO SMYD2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SMYD2 mRNA CTD PMID:25562108 and PMID:27989131 Smyd2 Mouse dicrotophos decreases expression ISO SMYD2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SMYD2 mRNA CTD PMID:28302478 Smyd2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SMYD2 mRNA CTD PMID:30529165 Smyd2 Mouse dorsomorphin multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smyd2 Mouse doxorubicin decreases expression ISO SMYD2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SMYD2 mRNA CTD PMID:29803840 Smyd2 Mouse Enterolactone multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMYD2 mRNA CTD PMID:19167446 Smyd2 Mouse ethanol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ethanol results in decreased expression of SMYD2 mRNA CTD PMID:35149083 Smyd2 Mouse ethyl methanesulfonate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SMYD2 mRNA CTD PMID:23649840 Smyd2 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of SMYD2 mRNA CTD PMID:34813904 Smyd2 Mouse flutamide increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Flutamide results in increased expression of SMYD2 mRNA CTD PMID:24136188 Smyd2 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SMYD2 mRNA] CTD PMID:22206623 Smyd2 Mouse gentamycin increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of SMYD2 mRNA CTD PMID:22061828 Smyd2 Mouse ivermectin decreases expression ISO SMYD2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SMYD2 protein CTD PMID:32959892 Smyd2 Mouse leflunomide decreases expression ISO Smyd2 (Rattus norvegicus) 6480464 leflunomide results in decreased expression of SMYD2 mRNA CTD PMID:24136188 Smyd2 Mouse levonorgestrel multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of SMYD2 mRNA CTD PMID:19074003 Smyd2 Mouse lipopolysaccharide multiple interactions EXP 6480464 [SMYD2 mRNA affects the susceptibility to [Lipopolysaccharides co-treated with IFNG protein]] which results in decreased expression of IL6 mRNA more ... CTD PMID:29718165 Smyd2 Mouse LLY-507 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 LLY-507 binds to and results in decreased activity of SMYD2 protein CTD PMID:25825497 Smyd2 Mouse menadione affects expression ISO SMYD2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SMYD2 mRNA CTD PMID:20044591 Smyd2 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of SMYD2 mRNA CTD PMID:34813904 Smyd2 Mouse methoxychlor affects methylation ISO Smyd2 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of SMYD2 gene CTD PMID:35440735 Smyd2 Mouse methyl methanesulfonate decreases expression ISO SMYD2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SMYD2 mRNA CTD PMID:23649840 Smyd2 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Smyd2 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SMYD2 gene CTD PMID:33148267 Smyd2 Mouse N-methyl-4-phenylpyridinium increases expression ISO Smyd2 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SMYD2 mRNA CTD PMID:28801915 Smyd2 Mouse panobinostat multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Mouse panobinostat increases expression ISO SMYD2 (Homo sapiens) 6480464 panobinostat results in increased expression of SMYD2 mRNA CTD PMID:26272509 Smyd2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SMYD2 mRNA CTD PMID:17562736 Smyd2 Mouse paracetamol decreases expression ISO SMYD2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SMYD2 mRNA CTD PMID:21420995 Smyd2 Mouse paraquat increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Paraquat results in increased expression of SMYD2 mRNA CTD PMID:32680482 Smyd2 Mouse permethrin multiple interactions ISO Smyd2 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SMYD2 gene CTD PMID:33148267 Smyd2 Mouse phenobarbital affects expression ISO SMYD2 (Homo sapiens) 6480464 Phenobarbital affects the expression of SMYD2 mRNA CTD PMID:19159669 Smyd2 Mouse phenylmercury acetate increases expression ISO SMYD2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SMYD2 mRNA CTD PMID:26272509 Smyd2 Mouse phenylmercury acetate multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of SMYD2 mRNA CTD PMID:23811191 Smyd2 Mouse S-adenosyl-L-methioninate affects binding ISO SMYD2 (Homo sapiens) 6480464 S-Adenosylmethionine binds to SMYD2 protein CTD PMID:21782458 Smyd2 Mouse S-adenosyl-L-methionine affects binding ISO SMYD2 (Homo sapiens) 6480464 S-Adenosylmethionine binds to SMYD2 protein CTD PMID:21782458 Smyd2 Mouse SB 431542 multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Smyd2 Mouse sodium arsenite decreases expression ISO SMYD2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SMYD2 mRNA CTD PMID:38568856 Smyd2 Mouse testosterone undecanoate multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of SMYD2 mRNA CTD PMID:19074003 Smyd2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SMYD2 mRNA CTD PMID:31919559 Smyd2 Mouse thioacetamide increases expression ISO Smyd2 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SMYD2 mRNA CTD PMID:23411599 and PMID:34492290 Smyd2 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of SMYD2 gene CTD PMID:35295148 Smyd2 Mouse trichostatin A increases expression ISO SMYD2 (Homo sapiens) 6480464 trichostatin A results in increased expression of SMYD2 mRNA CTD PMID:24935251 and PMID:26272509 Smyd2 Mouse trichostatin A multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Mouse triphenyl phosphate affects expression ISO SMYD2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SMYD2 mRNA CTD PMID:37042841 Smyd2 Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of SMYD2 mRNA CTD PMID:33045310 Smyd2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SMYD2 mRNA CTD PMID:17292431 Smyd2 Mouse valproic acid multiple interactions ISO SMYD2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMYD2 mRNA CTD PMID:27188386 Smyd2 Mouse valproic acid decreases expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SMYD2 mRNA CTD PMID:23179753 more ... Smyd2 Mouse valproic acid increases expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SMYD2 mRNA CTD PMID:23179753 more ... Smyd2 Mouse valproic acid affects expression ISO SMYD2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SMYD2 mRNA CTD PMID:25979313 Smyd2 Mouse vinclozolin increases expression ISO Smyd2 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of SMYD2 mRNA CTD PMID:22570695 Smyd2 Mouse vitamin E decreases expression ISO SMYD2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of SMYD2 mRNA CTD PMID:19244175 Smyd2 Mouse zinc atom decreases expression ISO SMYD2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SMYD2 mRNA CTD PMID:22171008 Smyd2 Mouse zinc(0) decreases expression ISO SMYD2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SMYD2 mRNA CTD PMID:22171008
Imported Annotations - PID (archival)
1.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
2.
Targeting protein lysine methylation and demethylation in cancers.
He Y, etal., Acta Biochim Biophys Sin (Shanghai). 2012 Jan;44(1):70-9. doi: 10.1093/abbs/gmr109.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
Modes of p53 regulation.
Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Smyd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 189,612,689 - 189,654,758 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 189,612,689 - 189,654,560 (-) Ensembl GRCm39 Ensembl GRCm38 1 189,880,492 - 189,922,495 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 189,880,492 - 189,922,363 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 191,704,371 - 191,746,167 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 191,581,280 - 191,623,076 (-) NCBI MGSCv36 mm8 Celera 1 196,790,858 - 196,832,656 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 95.03 NCBI
SMYD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 214,281,159 - 214,337,131 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 214,281,102 - 214,337,131 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 214,454,502 - 214,510,474 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 212,521,199 - 212,577,097 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 210,842,970 - 210,898,868 NCBI Celera 1 187,677,508 - 187,733,362 (+) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 185,129,703 - 185,185,600 (+) NCBI HuRef CHM1_1 1 215,726,941 - 215,782,851 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 213,520,680 - 213,576,627 (+) NCBI T2T-CHM13v2.0
Smyd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 103,956,470 - 103,997,774 (-) NCBI GRCr8 mRatBN7.2 13 101,425,270 - 101,466,576 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 101,425,273 - 101,466,576 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 103,940,656 - 103,981,564 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 105,329,429 - 105,370,669 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 102,534,981 - 102,578,302 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 108,642,156 - 108,686,293 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 108,642,156 - 108,686,290 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 113,261,746 - 113,302,399 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 106,160,147 - 106,201,473 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 106,349,462 - 106,390,567 (-) NCBI Celera 13 100,910,865 - 100,950,701 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
Smyd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 3,465,924 - 3,509,156 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 3,467,123 - 3,509,156 (-) NCBI ChiLan1.0 ChiLan1.0
SMYD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 35,065,100 - 35,121,132 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 35,029,402 - 35,085,432 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 189,849,167 - 189,905,193 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 194,729,116 - 194,761,043 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 194,729,116 - 194,761,045 (+) Ensembl panpan1.1 panPan2
SMYD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 12,281,581 - 12,331,294 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 12,281,710 - 12,331,164 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 11,855,760 - 11,905,351 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 11,991,481 - 12,041,301 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 11,991,446 - 12,044,237 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 11,915,043 - 11,964,795 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 12,019,583 - 12,068,986 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 12,143,792 - 12,193,251 (+) NCBI UU_Cfam_GSD_1.0
Smyd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 61,907,871 - 61,955,361 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936628 3,918,230 - 3,965,387 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936628 3,917,898 - 3,965,382 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMYD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 129,263,526 - 129,316,349 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 129,263,524 - 129,316,226 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 142,158,967 - 142,212,600 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMYD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 15,236,773 - 15,293,154 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 15,235,653 - 15,293,153 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 15,711,719 - 15,767,873 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smyd2
.
Predicted Target Of
Count of predictions: 602 Count of miRNA genes: 395 Interacting mature miRNAs: 449 Transcripts: ENSMUST00000027897, ENSMUST00000130804, ENSMUST00000132289, ENSMUST00000144452 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse
D1Mit117
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 189,923,915 - 189,924,016 UniSTS GRCm38 MGSCv37 1 191,747,794 - 191,747,895 UniSTS GRCm37 Celera 1 196,834,283 - 196,834,386 UniSTS Cytogenetic Map 1 H6 UniSTS cM Map 1 106.1 UniSTS Whitehead Genetic 1 110.4 UniSTS Whitehead_YAC 1 UniSTS
D1Mit409.1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 189,896,839 - 189,896,971 UniSTS GRCm38 MGSCv37 1 191,720,718 - 191,720,850 UniSTS GRCm37 Celera 1 196,807,031 - 196,807,163 UniSTS Cytogenetic Map 1 H6 UniSTS cM Map 1 106.3 UniSTS cM Map 1 UniSTS Whitehead Genetic 1 110.278 UniSTS Whitehead_YAC 1 UniSTS
D1Mit409
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 189,896,713 - 189,896,809 UniSTS GRCm38 MGSCv37 1 191,720,592 - 191,720,688 UniSTS GRCm37 Celera 1 196,806,903 - 196,807,001 UniSTS Cytogenetic Map 1 H6 UniSTS cM Map 1 106.3 UniSTS Whitehead Genetic 1 110.4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027897 ⟹ ENSMUSP00000027897
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 189,612,689 - 189,654,560 (-) Ensembl GRCm38.p6 Ensembl 1 189,880,492 - 189,922,363 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000130804
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 189,612,691 - 189,621,199 (-) Ensembl GRCm38.p6 Ensembl 1 189,880,494 - 189,889,002 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000132289
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 189,612,839 - 189,614,569 (-) Ensembl GRCm38.p6 Ensembl 1 189,880,642 - 189,882,372 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000144452
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 189,617,243 - 189,654,450 (-) Ensembl GRCm38.p6 Ensembl 1 189,885,046 - 189,922,253 (-) Ensembl
RefSeq Acc Id:
NM_026796 ⟹ NP_081072
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 189,612,689 - 189,654,488 (-) NCBI GRCm38 1 189,880,492 - 189,922,291 (-) NCBI MGSCv37 1 191,704,371 - 191,746,167 (-) RGD Celera 1 196,790,858 - 196,832,656 (-) RGD cM Map 1 ENTREZGENE
Sequence:
AGCGCCGCCAGCATGCGCGCCGAGGCCCGCGGCGGCCTGGAGCGCTTCTGCAGTGCGGGCAAGGGCCGGGGGCTCCGCGCGCTGCGGCCCTTCCACGTGGGCGACCTCCTCTTCTCCTGCCCGGCCTA
hide sequence
RefSeq Acc Id:
XM_006497146 ⟹ XP_006497209
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 189,612,689 - 189,654,739 (-) NCBI GRCm38 1 189,880,492 - 189,922,471 (-) NCBI
Sequence:
AGCGGGTGGTGGCCTGGGTGGCTTGGGACTCCAGCCTTCCTCACCGGGCAGCGCAGCCTGGCGGGTGCAGGCGGACTCCCGTGCGCGCGCCCTGCGCACCGCCCTCCCGCCCCGCGCTCCGGGGCGCG
hide sequence
RefSeq Acc Id:
XM_006497147 ⟹ XP_006497210
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 189,618,717 - 189,654,758 (-) NCBI GRCm38 1 189,886,520 - 189,922,495 (-) NCBI
Sequence:
GGACGCTGTCTGCGGGCACAGCGGGTGGTGGCCTGGGTGGCTTGGGACTCCAGCCTTCCTCACCGGGCAGCGCAGCCTGGCGGGTGCAGGCGGACTCCCGTGCGCGCGCCCTGCGCACCGCCCTCCCG
hide sequence
RefSeq Acc Id:
XM_017320186 ⟹ XP_017175675
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 189,612,689 - 189,654,414 (-) NCBI GRCm38 1 189,880,492 - 189,922,217 (-) NCBI
Sequence:
CCGCGCGCTGCGGCCCTTCCACGTGGGCGACCTCCTCTTCTCCTGCCCGGCCTACGCCTGCGTG
hide sequence
RefSeq Acc Id:
NP_081072 ⟸ NM_026796
- UniProtKB:
Q8R5A0 (UniProtKB/Swiss-Prot), Q3UBQ2 (UniProtKB/Swiss-Prot)
- Sequence:
MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKL
hide sequence
RefSeq Acc Id:
XP_006497209 ⟸ XM_006497146
- Peptide Label:
isoform X1
- Sequence:
MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSK
hide sequence
RefSeq Acc Id:
XP_006497210 ⟸ XM_006497147
- Peptide Label:
isoform X2
- Sequence:
MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKL
hide sequence
RefSeq Acc Id:
XP_017175675 ⟸ XM_017320186
- Peptide Label:
isoform X3
- UniProtKB:
Q9D177 (UniProtKB/TrEMBL)
- Sequence:
MNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVF
hide sequence
Ensembl Acc Id:
ENSMUSP00000027897 ⟸ ENSMUST00000027897
RGD ID: 6876072 Promoter ID: EPDNEW_M1487 Type: initiation region Name: Smyd2_1 Description: Mus musculus SET and MYND domain containing 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 189,922,297 - 189,922,357 EPDNEW
RGD ID: 6848557 Promoter ID: MM_TRO:725 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: MTR015010.1.3069.5 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,704,046 - 191,704,546 (-) MPROMDB
RGD ID: 6818496 Promoter ID: MM_KWN:3274 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, MEF_B4, MEF_B6 Transcripts: OTTMUST00000050715 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,706,216 - 191,706,716 (-) MPROMDB
RGD ID: 6848556 Promoter ID: MM_TRO:726 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: MEF_B4 Transcripts: MTR015010.1.3069.3 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,707,506 - 191,708,006 (-) MPROMDB
RGD ID: 6818497 Promoter ID: MM_KWN:3275 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: MEF_B6 Transcripts: OTTMUST00000041404, UC007EAY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,712,536 - 191,713,036 (-) MPROMDB
RGD ID: 6818500 Promoter ID: MM_KWN:3276 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: UC007EAZ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,733,996 - 191,734,496 (-) MPROMDB
RGD ID: 6818498 Promoter ID: MM_KWN:3277 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000041402, OTTMUST00000041403 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 191,745,924 - 191,746,424 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Smyd2
SET and MYND domain containing 2
1110020E07Rik
RIKEN cDNA 1110020E07 gene
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
1110020E07Rik
RIKEN cDNA 1110020E07 gene
Smyd2
SET and MYND domain containing 2
Symbol and/or name change
5135510 APPROVED
