Symbol:
Decr1
Name:
2,4-dienoyl-CoA reductase 1
RGD ID:
70999
Description:
Predicted to enable 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding activity; and identical protein binding activity. Predicted to be involved in fatty acid beta-oxidation and positive regulation of cold-induced thermogenesis. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of catalytic complex. Predicted to be active in mitochondrion. Orthologous to human DECR1 (2,4-dienoyl-CoA reductase 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial; 2,4-dienoyl-CoA reductase, mitochondrial; 4-enoyl-CoA reductase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DECR1 (2,4-dienoyl-CoA reductase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Decr1 (2,4-dienoyl CoA reductase 1, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Decr1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DECR1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DECR1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Decr1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DECR1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DECR1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Decr1 (2,4-dienoyl-CoA reductase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DECR1 (2,4-dienoyl-CoA reductase 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Decr1 (2,4-dienoyl CoA reductase 1, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
decr1 (2,4-dienoyl CoA reductase 1, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F53C11.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
decr-1.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
decr-1.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
decr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 34,208,195 - 34,236,074 (-) NCBI GRCr8 mRatBN7.2 5 29,411,172 - 29,439,054 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 29,411,172 - 29,439,018 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 31,567,474 - 31,595,241 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 33,160,140 - 33,187,907 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 33,120,325 - 33,148,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 29,573,893 - 29,601,731 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 29,573,898 - 29,601,748 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 34,253,236 - 34,280,749 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 30,492,196 - 30,520,172 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 30,492,195 - 30,520,172 (-) NCBI Celera 5 28,616,707 - 28,644,572 (-) NCBI Celera Cytogenetic Map 5 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Decr1 Rat (+)-dexrazoxane multiple interactions ISO RGD:736377 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of DECR1 mRNA CTD PMID:26873546 Decr1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DECR1 mRNA] CTD PMID:31150632 Decr1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:736377 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DECR1 mRNA CTD PMID:36331819 Decr1 Rat 1,1-dichloroethene decreases expression ISO RGD:736377 6480464 vinylidene chloride results in decreased expression of DECR1 mRNA CTD PMID:26682919 Decr1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:736377 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of DECR1 mRNA] CTD PMID:22206623 Decr1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:736377 6480464 1,2-Dimethylhydrazine results in decreased expression of DECR1 mRNA CTD PMID:22206623 Decr1 Rat 17alpha-ethynylestradiol affects expression ISO RGD:736377 6480464 Ethinyl Estradiol affects the expression of DECR1 mRNA CTD PMID:17555576 Decr1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of DECR1 mRNA CTD PMID:26496021 Decr1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DECR1 mRNA CTD PMID:32145629 Decr1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of DECR1 protein CTD PMID:32145629 Decr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:736377 6480464 Tetrachlorodibenzodioxin results in decreased expression of DECR1 mRNA CTD PMID:19770486|PMID:31961203 Decr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736377 6480464 Tetrachlorodibenzodioxin affects the expression of DECR1 mRNA CTD PMID:21570461 Decr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DECR1 mRNA CTD PMID:21215274 Decr1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of DECR1 mRNA CTD PMID:21346803 Decr1 Rat 2-methylcholine affects expression ISO RGD:733605 6480464 beta-methylcholine affects the expression of DECR1 mRNA CTD PMID:21179406 Decr1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:733605 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Decr1 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:736377 6480464 4,4'-diaminodiphenylmethane results in increased expression of DECR1 mRNA CTD PMID:18648102 Decr1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:736377 6480464 bisphenol S results in increased expression of DECR1 mRNA CTD PMID:39298647 Decr1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733605 6480464 bisphenol S results in increased expression of DECR1 protein CTD PMID:34186270 Decr1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:736377 6480464 Fenretinide results in decreased expression of DECR1 mRNA CTD PMID:28973697 Decr1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime multiple interactions ISO RGD:733605 6480464 [6-(4-chlorophenyl)imidazo(2,1-b)(1,3)thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime co-treated with Oleic Acid] results in increased expression of DECR1 mRNA CTD PMID:30611723 Decr1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DECR1 mRNA CTD PMID:30047161 Decr1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of DECR1 mRNA CTD PMID:31881176 Decr1 Rat actinomycin D multiple interactions ISO RGD:733605 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DECR1 protein CTD PMID:38460933 Decr1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DECR1 mRNA CTD PMID:35163327 Decr1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DECR1 mRNA CTD PMID:30047161 Decr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DECR1 mRNA CTD PMID:16483693 Decr1 Rat arsenite(3-) multiple interactions ISO RGD:733605 6480464 arsenite promotes the reaction [G3BP1 protein binds to DECR1 mRNA] CTD PMID:32406909 Decr1 Rat arsenous acid increases expression ISO RGD:733605 6480464 Arsenic Trioxide results in increased expression of DECR1 mRNA CTD PMID:22521957 Decr1 Rat atrazine decreases expression ISO RGD:733605 6480464 Atrazine results in decreased expression of DECR1 mRNA CTD PMID:22378314 Decr1 Rat azoxystrobin increases expression ISO RGD:733605 6480464 azoxystrobin results in increased expression of DECR1 mRNA CTD PMID:33512557 Decr1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat benzo[a]pyrene decreases expression ISO RGD:736377 6480464 Benzo(a)pyrene results in decreased expression of DECR1 mRNA CTD PMID:23735875 Decr1 Rat benzo[a]pyrene decreases expression ISO RGD:733605 6480464 Benzo(a)pyrene results in decreased expression of DECR1 mRNA CTD PMID:32234424 Decr1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:736377 6480464 Diethylhexyl Phthalate results in increased expression of DECR1 mRNA CTD PMID:19850644 Decr1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:736377 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of DECR1 mRNA] CTD PMID:19850644 Decr1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of DECR1 mRNA CTD PMID:26496021 Decr1 Rat bisphenol A decreases expression ISO RGD:733605 6480464 bisphenol A results in decreased expression of DECR1 protein CTD PMID:34186270 Decr1 Rat bisphenol A increases expression ISO RGD:733605 6480464 bisphenol A results in increased expression of DECR1 protein CTD PMID:37567409 Decr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DECR1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:30816183|PMID:32145629|PMID:34947998 Decr1 Rat bisphenol A multiple interactions ISO RGD:733605 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Decr1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DECR1 mRNA CTD PMID:25181051 Decr1 Rat bisphenol A decreases expression ISO RGD:736377 6480464 bisphenol A results in decreased expression of DECR1 mRNA CTD PMID:26063408 Decr1 Rat bisphenol AF increases expression ISO RGD:733605 6480464 bisphenol AF results in increased expression of DECR1 protein CTD PMID:34186270 Decr1 Rat Bisphenol B increases expression ISO RGD:733605 6480464 bisphenol B results in increased expression of DECR1 protein CTD PMID:34186270 Decr1 Rat bisphenol F increases expression ISO RGD:733605 6480464 bisphenol F results in increased expression of DECR1 protein CTD PMID:34186270 Decr1 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of DECR1 mRNA CTD PMID:24136188 Decr1 Rat cadmium acetate affects expression EXP 6480464 cadmium acetate affects the expression of DECR1 mRNA CTD PMID:16249259 Decr1 Rat cadmium atom increases expression ISO RGD:733605 6480464 Cadmium results in increased expression of DECR1 mRNA CTD PMID:24376830 Decr1 Rat cadmium atom multiple interactions ISO RGD:733605 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DECR1 more ... CTD PMID:35301059 Decr1 Rat cadmium dichloride multiple interactions ISO RGD:733605 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DECR1 more ... CTD PMID:35301059 Decr1 Rat carbon nanotube increases expression ISO RGD:736377 6480464 Nanotubes, Carbon analog results in increased expression of DECR1 mRNA CTD PMID:25620056 Decr1 Rat chlorotoluron decreases expression ISO RGD:733605 6480464 chlortoluron results in decreased expression of DECR1 mRNA CTD PMID:39207506 Decr1 Rat choline multiple interactions ISO RGD:736377 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Decr1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of DECR1 protein CTD PMID:22023808 Decr1 Rat cisplatin increases expression ISO RGD:733605 6480464 Cisplatin results in increased expression of DECR1 mRNA CTD PMID:27594783 Decr1 Rat clofibrate multiple interactions ISO RGD:736377 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DECR1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Decr1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of DECR1 mRNA; Clofibrate results in increased expression of DECR1 more ... CTD PMID:12851107|PMID:18246545|PMID:27665778|PMID:32741897|PMID:7852859 Decr1 Rat clofibrate increases expression ISO RGD:736377 6480464 Clofibrate results in increased expression of DECR1 mRNA CTD PMID:17585979|PMID:23811191|PMID:25270620|PMID:30629241 Decr1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of DECR1 mRNA CTD PMID:18246545|PMID:19483382 Decr1 Rat cobalt dichloride decreases expression ISO RGD:733605 6480464 cobaltous chloride results in decreased expression of DECR1 mRNA CTD PMID:19376846 Decr1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of DECR1 mRNA CTD PMID:24386269 Decr1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of DECR1 mRNA CTD PMID:22465980 Decr1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of DECR1 mRNA CTD PMID:22465980 Decr1 Rat copper(II) sulfate decreases expression ISO RGD:733605 6480464 Copper Sulfate results in decreased expression of DECR1 mRNA CTD PMID:19549813 Decr1 Rat cyclosporin A decreases expression ISO RGD:736377 6480464 Cyclosporine results in decreased expression of DECR1 mRNA CTD PMID:19770486 Decr1 Rat cyclosporin A decreases expression ISO RGD:733605 6480464 Cyclosporine results in decreased expression of DECR1 mRNA CTD PMID:20106945|PMID:25562108|PMID:27989131 Decr1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of DECR1 mRNA CTD PMID:16962226 Decr1 Rat dexamethasone multiple interactions ISO RGD:733605 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Decr1 Rat diarsenic trioxide increases expression ISO RGD:733605 6480464 Arsenic Trioxide results in increased expression of DECR1 mRNA CTD PMID:22521957 Decr1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DECR1 mRNA CTD PMID:21266533 Decr1 Rat dichloroacetic acid increases expression ISO RGD:736377 6480464 Dichloroacetic Acid results in increased expression of DECR1 mRNA CTD PMID:28962523 Decr1 Rat diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of DECR1 protein CTD PMID:25772430 Decr1 Rat dicrotophos decreases expression ISO RGD:733605 6480464 dicrotophos results in decreased expression of DECR1 mRNA CTD PMID:28302478 Decr1 Rat dorsomorphin multiple interactions ISO RGD:733605 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Decr1 Rat doxorubicin multiple interactions ISO RGD:736377 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of DECR1 mRNA CTD PMID:26873546 Decr1 Rat doxorubicin decreases expression ISO RGD:736377 6480464 Doxorubicin results in decreased expression of DECR1 mRNA CTD PMID:26873546 Decr1 Rat ethanol increases expression ISO RGD:736377 6480464 Ethanol results in increased expression of DECR1 mRNA CTD PMID:30319688 Decr1 Rat ethyl methanesulfonate increases expression ISO RGD:733605 6480464 Ethyl Methanesulfonate results in increased expression of DECR1 mRNA CTD PMID:23649840 Decr1 Rat farnesol multiple interactions ISO RGD:733605 6480464 [Farnesol analog co-treated with Oleic Acid] results in decreased expression of DECR1 mRNA CTD PMID:30611723 Decr1 Rat fenofibrate increases expression ISO RGD:736377 6480464 Fenofibrate results in increased expression of DECR1 mRNA CTD PMID:11798191 Decr1 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of DECR1 mRNA; Fenofibrate results in increased expression of DECR1 more ... CTD PMID:20118634|PMID:27665778|PMID:32741897 Decr1 Rat fenofibrate affects expression EXP 6480464 Fenofibrate affects the expression of DECR1 mRNA CTD PMID:20801182 Decr1 Rat fenthion decreases expression ISO RGD:736377 6480464 Fenthion results in decreased expression of DECR1 mRNA CTD PMID:34813904 Decr1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DECR1 mRNA CTD PMID:21525395 Decr1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of DECR1 mRNA CTD PMID:24136188|PMID:24793618 Decr1 Rat folic acid multiple interactions ISO RGD:736377 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992|PMID:22206623 Decr1 Rat furfural multiple interactions ISO RGD:733605 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Decr1 Rat gemfibrozil increases expression EXP 6480464 Gemfibrozil results in increased expression of DECR1 mRNA CTD PMID:27665778 Decr1 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of DECR1 mRNA CTD PMID:15345336 Decr1 Rat GW 4064 multiple interactions ISO RGD:733605 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of DECR1 mRNA CTD PMID:30611723 Decr1 Rat indometacin multiple interactions ISO RGD:733605 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Decr1 Rat inulin multiple interactions ISO RGD:736377 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of DECR1 mRNA CTD PMID:36331819 Decr1 Rat ivermectin decreases expression ISO RGD:733605 6480464 Ivermectin results in decreased expression of DECR1 protein CTD PMID:32959892 Decr1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat L-methionine multiple interactions ISO RGD:736377 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Decr1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of DECR1 mRNA CTD PMID:24136188 Decr1 Rat limonene increases expression EXP 6480464 limonene results in increased expression of DECR1 mRNA CTD PMID:12815608 Decr1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of DECR1 mRNA CTD PMID:16393664|PMID:30467583 Decr1 Rat methidathion decreases expression ISO RGD:736377 6480464 methidathion results in decreased expression of DECR1 mRNA CTD PMID:34813904 Decr1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DECR1 mRNA CTD PMID:30047161 Decr1 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of DECR1 mRNA CTD PMID:21515302 Decr1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of DECR1 protein CTD PMID:19716841 Decr1 Rat NADP zwitterion multiple interactions ISO RGD:733605 6480464 NADP binds to and results in increased activity of DECR1 protein CTD PMID:25526675 Decr1 Rat NADP(+) multiple interactions ISO RGD:733605 6480464 NADP binds to and results in increased activity of DECR1 protein CTD PMID:25526675 Decr1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of DECR1 mRNA CTD PMID:24136188 Decr1 Rat nickel atom decreases expression ISO RGD:733605 6480464 Nickel results in decreased expression of DECR1 mRNA CTD PMID:23195993 Decr1 Rat niclosamide decreases expression ISO RGD:733605 6480464 Niclosamide results in decreased expression of DECR1 mRNA CTD PMID:22576131 Decr1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of DECR1 mRNA CTD PMID:24136188 Decr1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of DECR1 mRNA CTD PMID:33484710 Decr1 Rat Nutlin-3 multiple interactions ISO RGD:733605 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DECR1 protein CTD PMID:38460933 Decr1 Rat okadaic acid decreases expression ISO RGD:733605 6480464 Okadaic Acid results in decreased expression of DECR1 mRNA CTD PMID:38832940 Decr1 Rat oleic acid multiple interactions ISO RGD:733605 6480464 [6-(4-chlorophenyl)imidazo(2,1-b)(1,3)thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime co-treated with Oleic Acid] results in increased expression of DECR1 mRNA; [Farnesol analog more ... CTD PMID:30611723 Decr1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DECR1 mRNA CTD PMID:25729387 Decr1 Rat paracetamol multiple interactions ISO RGD:736377 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DECR1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Decr1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DECR1 mRNA CTD PMID:33387578 Decr1 Rat paracetamol decreases expression ISO RGD:733605 6480464 Acetaminophen results in decreased expression of DECR1 mRNA CTD PMID:25704631|PMID:29067470 Decr1 Rat paracetamol affects expression ISO RGD:736377 6480464 Acetaminophen affects the expression of DECR1 mRNA CTD PMID:17562736 Decr1 Rat perfluorohexanesulfonic acid increases expression ISO RGD:736377 6480464 perfluorohexanesulfonic acid results in increased expression of DECR1 mRNA CTD PMID:28558994 Decr1 Rat perfluorononanoic acid increases expression ISO RGD:736377 6480464 perfluoro-n-nonanoic acid results in increased expression of DECR1 mRNA CTD PMID:28558994 Decr1 Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:736377 6480464 perfluorooctane sulfonic acid affects the expression of DECR1 mRNA CTD PMID:19429403 Decr1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:736377 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DECR1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Decr1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:736377 6480464 perfluorooctane sulfonic acid results in decreased expression of DECR1 protein CTD PMID:26178269 Decr1 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:736377 6480464 perfluorooctane sulfonic acid results in increased expression of DECR1 mRNA CTD PMID:28558994 Decr1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of DECR1 mRNA CTD PMID:18692542|PMID:19162173 Decr1 Rat perfluorooctanoic acid affects expression ISO RGD:736377 6480464 perfluorooctanoic acid affects the expression of DECR1 mRNA CTD PMID:18281256|PMID:19429403 Decr1 Rat perfluorooctanoic acid increases expression ISO RGD:733605 6480464 perfluorooctanoic acid results in increased expression of DECR1 protein CTD PMID:26879310 Decr1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DECR1 mRNA CTD PMID:35163327 Decr1 Rat perfluorooctanoic acid multiple interactions ISO RGD:736377 6480464 Dietary Fats, Unsaturated promotes the reaction [perfluorooctanoic acid results in increased expression of DECR1 mRNA] CTD PMID:23626681 Decr1 Rat perfluorooctanoic acid increases expression ISO RGD:736377 6480464 perfluorooctanoic acid results in increased expression of DECR1 mRNA CTD PMID:23626681|PMID:28558994|PMID:30711707 Decr1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of DECR1 mRNA; perfluorooctanoic acid results in increased expression more ... CTD PMID:16221955|PMID:19162173|PMID:28511854|PMID:34958885 Decr1 Rat permethrin increases expression ISO RGD:736377 6480464 Permethrin results in increased expression of DECR1 mRNA CTD PMID:30629241 Decr1 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of DECR1 mRNA CTD PMID:31324951 Decr1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of DECR1 mRNA CTD PMID:19162173 Decr1 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of DECR1 mRNA CTD PMID:15170462 Decr1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of DECR1 mRNA CTD PMID:22484513 Decr1 Rat pirinixic acid multiple interactions ISO RGD:736377 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Decr1 Rat pirinixic acid increases expression ISO RGD:736377 6480464 pirinixic acid results in increased expression of DECR1 mRNA CTD PMID:11798191|PMID:16357043|PMID:17426115|PMID:18301758|PMID:20813756|PMID:23811191 Decr1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DECR1 mRNA CTD PMID:16940010|PMID:19162173|PMID:22484513|PMID:27665778|PMID:32741897 Decr1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat potassium dichromate decreases expression ISO RGD:736377 6480464 Potassium Dichromate results in decreased expression of DECR1 mRNA CTD PMID:23608068 Decr1 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of DECR1 mRNA CTD PMID:27225895 Decr1 Rat pravastatin decreases expression ISO RGD:736377 6480464 Pravastatin results in decreased expression of DECR1 mRNA CTD PMID:27225895 Decr1 Rat propiconazole decreases expression ISO RGD:736377 6480464 propiconazole results in decreased expression of DECR1 mRNA CTD PMID:21278054 Decr1 Rat quercetin decreases expression ISO RGD:733605 6480464 Quercetin results in decreased expression of DECR1 mRNA CTD PMID:21632981 Decr1 Rat resveratrol multiple interactions ISO RGD:733605 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of DECR1 mRNA CTD PMID:23557933 Decr1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DECR1 mRNA CTD PMID:28374803 Decr1 Rat rotenone increases expression ISO RGD:733605 6480464 Rotenone results in increased expression of DECR1 mRNA CTD PMID:33512557 Decr1 Rat SB 431542 multiple interactions ISO RGD:733605 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of DECR1 more ... CTD PMID:27188386|PMID:37664457 Decr1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DECR1 protein CTD PMID:29459688 Decr1 Rat sodium chloride multiple interactions ISO RGD:733605 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Decr1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of DECR1 mRNA CTD PMID:19281266 Decr1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of DECR1 mRNA CTD PMID:16684804 Decr1 Rat streptozocin multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of DECR1 mRNA] CTD PMID:16684804 Decr1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DECR1 mRNA CTD PMID:30047161 Decr1 Rat sulforaphane increases expression ISO RGD:736377 6480464 sulforaphane results in increased expression of DECR1 mRNA CTD PMID:30529165 Decr1 Rat sunitinib decreases expression ISO RGD:733605 6480464 Sunitinib results in decreased expression of DECR1 mRNA CTD PMID:31533062 Decr1 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of DECR1 mRNA CTD PMID:21515302 Decr1 Rat tetrachloroethene increases expression ISO RGD:736377 6480464 Tetrachloroethylene results in increased expression of DECR1 mRNA CTD PMID:28973375 Decr1 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of DECR1 mRNA CTD PMID:15963342 Decr1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DECR1 mRNA CTD PMID:31150632 Decr1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DECR1 mRNA] CTD PMID:31150632 Decr1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of DECR1 protein CTD PMID:35544339 Decr1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of DECR1 mRNA CTD PMID:19483382 Decr1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DECR1 mRNA CTD PMID:34492290 Decr1 Rat titanium dioxide decreases methylation ISO RGD:736377 6480464 titanium dioxide results in decreased methylation of DECR1 gene CTD PMID:35295148 Decr1 Rat titanium dioxide increases methylation ISO RGD:736377 6480464 titanium dioxide results in increased methylation of DECR1 gene CTD PMID:35295148 Decr1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DECR1 mRNA CTD PMID:25729387 Decr1 Rat trichloroethene increases expression ISO RGD:736377 6480464 Trichloroethylene results in increased expression of DECR1 mRNA CTD PMID:25549359 Decr1 Rat trichostatin A increases expression ISO RGD:733605 6480464 trichostatin A results in increased expression of DECR1 mRNA CTD PMID:24935251|PMID:26272509 Decr1 Rat trichostatin A multiple interactions ISO RGD:733605 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Decr1 Rat triphenyl phosphate affects expression ISO RGD:733605 6480464 triphenyl phosphate affects the expression of DECR1 mRNA CTD PMID:37042841 Decr1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of DECR1 mRNA CTD PMID:21515302 Decr1 Rat tunicamycin increases expression ISO RGD:733605 6480464 Tunicamycin results in increased expression of DECR1 mRNA CTD PMID:22378314 Decr1 Rat urethane decreases expression ISO RGD:733605 6480464 Urethane results in decreased expression of DECR1 mRNA CTD PMID:28818685 Decr1 Rat valproic acid decreases methylation ISO RGD:733605 6480464 Valproic Acid results in decreased methylation of DECR1 gene CTD PMID:29154799 Decr1 Rat valproic acid decreases expression ISO RGD:733605 6480464 Valproic Acid results in decreased expression of DECR1 mRNA CTD PMID:25716160 Decr1 Rat valproic acid multiple interactions ISO RGD:733605 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Decr1 Rat valproic acid increases expression ISO RGD:733605 6480464 Valproic Acid results in increased expression of DECR1 mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509 Decr1 Rat valproic acid affects expression ISO RGD:736377 6480464 Valproic Acid affects the expression of DECR1 mRNA CTD PMID:17292431|PMID:17963808 Decr1 Rat vanadyl sulfate multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of DECR1 mRNA] CTD PMID:16684804 Decr1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DECR1 mRNA CTD PMID:23034163 Decr1 Rat zaragozic acid A affects expression ISO RGD:736377 6480464 squalestatin 1 affects the expression of DECR1 mRNA CTD PMID:27225895 Decr1 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of DECR1 mRNA CTD PMID:27225895
(+)-dexrazoxane (ISO) (+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) azoxystrobin (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium acetate (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlorotoluron (ISO) choline (ISO) cisplatin (EXP,ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) diclofenac (EXP) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) farnesol (ISO) fenofibrate (EXP,ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) furfural (ISO) gemfibrozil (EXP) glutathione (EXP) GW 4064 (ISO) indometacin (ISO) inulin (ISO) ivermectin (ISO) L-ethionine (EXP) L-methionine (ISO) leflunomide (EXP) limonene (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) Muraglitazar (EXP) N-nitrosomorpholine (EXP) NADP zwitterion (ISO) NADP(+) (ISO) nefazodone (EXP) nickel atom (ISO) niclosamide (ISO) nimesulide (EXP) nitrofen (EXP) Nutlin-3 (ISO) okadaic acid (ISO) oleic acid (ISO) omeprazole (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenformin (EXP) phenobarbital (EXP) picrotoxin (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pravastatin (EXP,ISO) propiconazole (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (EXP) sodium chloride (ISO) Soman (EXP) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) Tesaglitazar (EXP) tetrachloroethene (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (EXP) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vanadyl sulfate (EXP) vinclozolin (EXP) zaragozic acid A (EXP,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
cDNA cloning of rat liver 2,4-dienoyl-CoA reductase.
Hirose A, etal., Biochim Biophys Acta 1990 Jul 30;1049(3):346-9.
4.
Gene Data Set
MGD Curation, June 12, 2002
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Mitochondrial 2,4-dienoyl-CoA reductase deficiency in mice results in severe hypoglycemia with stress intolerance and unimpaired ketogenesis.
Miinalainen IJ, etal., PLoS Genet. 2009 Jul;5(7):e1000543. doi: 10.1371/journal.pgen.1000543. Epub 2009 Jul 3.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Decr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 34,208,195 - 34,236,074 (-) NCBI GRCr8 mRatBN7.2 5 29,411,172 - 29,439,054 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 29,411,172 - 29,439,018 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 31,567,474 - 31,595,241 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 33,160,140 - 33,187,907 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 33,120,325 - 33,148,092 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 29,573,893 - 29,601,731 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 29,573,898 - 29,601,748 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 34,253,236 - 34,280,749 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 30,492,196 - 30,520,172 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 30,492,195 - 30,520,172 (-) NCBI Celera 5 28,616,707 - 28,644,572 (-) NCBI Celera Cytogenetic Map 5 q13 NCBI
DECR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 90,001,477 - 90,053,633 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 90,001,405 - 90,053,633 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 91,013,705 - 91,065,861 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 91,082,756 - 91,133,403 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 91,082,755 - 91,133,403 NCBI Celera 8 87,208,502 - 87,259,149 (+) NCBI Celera Cytogenetic Map 8 q21.3 NCBI HuRef 8 86,223,894 - 86,274,542 (+) NCBI HuRef CHM1_1 8 91,054,504 - 91,105,151 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 91,125,148 - 91,177,304 (+) NCBI T2T-CHM13v2.0
Decr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 15,917,240 - 15,945,377 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 15,917,240 - 15,945,507 (-) Ensembl GRCm39 Ensembl GRCm38 4 15,917,240 - 15,945,377 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 15,917,240 - 15,945,507 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 15,844,387 - 15,872,654 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 15,844,387 - 15,872,654 (-) NCBI MGSCv36 mm8 Celera 4 15,720,515 - 15,748,774 (-) NCBI Celera Cytogenetic Map 4 A2 NCBI cM Map 4 6.66 NCBI
Decr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 6,893,231 - 6,931,754 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 6,893,231 - 6,931,754 (+) NCBI ChiLan1.0 ChiLan1.0
DECR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 107,394,558 - 107,461,629 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 82,934,216 - 83,001,276 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 86,690,816 - 86,755,379 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 88,642,676 - 88,693,224 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 88,642,172 - 88,693,224 (+) Ensembl panpan1.1 panPan2
DECR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 35,495,348 - 35,544,955 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 35,495,261 - 35,544,955 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 35,646,866 - 35,697,851 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 35,692,661 - 35,742,310 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 35,692,704 - 35,744,794 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 35,684,839 - 35,729,541 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 35,703,896 - 35,747,852 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 36,138,067 - 36,183,640 (+) NCBI UU_Cfam_GSD_1.0
Decr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 43,936,906 - 43,975,997 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936544 3,816,653 - 3,853,632 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936544 3,816,543 - 3,853,288 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DECR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 46,731,360 - 46,767,422 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 46,731,359 - 46,767,427 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 51,207,727 - 51,243,866 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DECR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 85,086,843 - 85,129,267 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 85,086,874 - 85,129,160 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 55,747,223 - 55,792,311 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Decr1
.
Predicted Target Of
Count of predictions: 100 Count of miRNA genes: 87 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000011330 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 2312562 Pur18 Proteinuria QTL 18 2.6 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 5 2138965 32656739 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 1549901 Neudeg2 Neurodegradation QTL 2 4 0 nervous system integrity trait (VT:0010566) mononuclear cell count (CMO:0002119) 5 24838710 44045280 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011330 ⟹ ENSRNOP00000011330
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 29,411,172 - 29,439,011 (-) Ensembl Rnor_6.0 Ensembl 5 29,573,898 - 29,601,748 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097769 ⟹ ENSRNOP00000086268
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 29,411,172 - 29,439,011 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119084 ⟹ ENSRNOP00000093824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 29,411,203 - 29,439,018 (-) Ensembl
RefSeq Acc Id:
NM_057197 ⟹ NP_476545
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 34,208,195 - 34,236,033 (-) NCBI mRatBN7.2 5 29,411,172 - 29,439,011 (-) NCBI Rnor_6.0 5 29,573,893 - 29,601,731 (-) NCBI Rnor_5.0 5 34,253,236 - 34,280,749 (-) NCBI RGSC_v3.4 5 30,492,196 - 30,520,172 (-) RGD Celera 5 28,616,707 - 28,644,572 (-) NCBI
Sequence:
GGGCGGGGCGGACCCTGACACTAAGGACTCAGTTCTGCTGCAAACATGGCGCTGCTGGCCCGTGCGTTCTTTGCTGGGGTGTCCCGCCTCCCCTGCGATCCCGGTCCTCAGAGGTTTTTCAGCTTTGG
hide sequence
RefSeq Acc Id:
XM_039109166 ⟹ XP_038965094
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 34,208,203 - 34,236,074 (-) NCBI mRatBN7.2 5 29,411,180 - 29,439,054 (-) NCBI
RefSeq Acc Id:
XM_063287086 ⟹ XP_063143156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 34,209,028 - 34,236,074 (-) NCBI
RefSeq Acc Id:
NP_476545 ⟸ NM_057197
- Peptide Label:
precursor
- UniProtKB:
Q6PCV4 (UniProtKB/Swiss-Prot), Q64591 (UniProtKB/Swiss-Prot), G3V734 (UniProtKB/TrEMBL), A6IIA8 (UniProtKB/TrEMBL)
- Sequence:
MALLARAFFAGVSRLPCDPGPQRFFSFGTKTLYQSIDAPQSKFFPPILKPMLPPNAFQGKVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKTGNKVYAIRCDVRDPDMVHNTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000011330 ⟸ ENSRNOT00000011330
RefSeq Acc Id:
XP_038965094 ⟸ XM_039109166
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000086268 ⟸ ENSRNOT00000097769
Ensembl Acc Id:
ENSRNOP00000093824 ⟸ ENSRNOT00000119084
RefSeq Acc Id:
XP_063143156 ⟸ XM_063287086
- Peptide Label:
isoform X2
RGD ID: 13693579 Promoter ID: EPDNEW_R4104 Type: multiple initiation site Name: Decr1_1 Description: 2,4-dienoyl-CoA reductase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 29,601,701 - 29,601,761 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-12-15
Decr1
2,4-dienoyl-CoA reductase 1
Decr1
2,4-dienoyl CoA reductase 1, mitochondrial
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Decr1
2,4-dienoyl CoA reductase 1, mitochondrial
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
