Slc27a5 (solute carrier family 27 member 5)

Advanced Search (OLGA)

Gene: Slc27a5 (solute carrier family 27 member 5) Rattus norvegicus

Analyze

Symbol:

Slc27a5

Name:

solute carrier family 27 member 5

RGD ID:

708535

Description:

Enables cholate-CoA ligase activity. Involved in bile acid metabolic process. Part of protein-containing complex. Orthologous to human SLC27A5 (solute carrier family 27 member 5); PARTICIPATES IN bile acid biosynthetic pathway; cerebrotendinous xanthomatosis pathway; congenital bile acid synthesis defect pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BA-CoA ligase; BACS; BAL; bile acid CoA ligase; bile acid-CoA ligase; bile acyl-CoA synthetase; cholate--CoA ligase; FATP-5; fatty acid transport protein 5; LOC79111; long-chain fatty acid transport protein 5; long-chain-fatty-acid--CoA ligase; rBAL-1; solute carrier family 27 (fatty acid transporter), member 5; very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Slc27a5^m1Mcwi Slc27a5^m2Mcwi

Genetic Models:

FHH-Slc27a5^m1Mcwi BN-Slc27a5^m2Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	82,688,742 - 82,699,335 (-)	NCBI		GRCr8
mRatBN7.2	1	73,616,556 - 73,627,149 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	73,616,564 - 73,627,172 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	78,996,966 - 79,007,611 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	87,561,304 - 87,571,949 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	80,752,046 - 80,762,691 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	65,576,599 - 65,587,192 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	65,576,535 - 65,587,186 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	66,387,832 - 66,398,425 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	72,924,630 - 72,935,223 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	73,002,740 - 73,013,332 (+)	NCBI
Celera	1	60,212,177 - 60,222,770 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

myoepithelioma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

berberine (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

buta-1,3-diene (ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

cholic acid (ISO)

choline (ISO)

cisplatin (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

deoxycholic acid (ISO)

dicrotophos (ISO)

dioxygen (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fluoxetine (EXP)

flutamide (EXP)

formaldehyde (ISO)

fumonisin B1 (ISO)

furan (EXP)

glafenine (EXP)

glycidol (EXP)

GW 4064 (ISO)

imipenem hydrate (ISO)

L-methionine (ISO)

Lasiocarpine (ISO)

lead diacetate (ISO)

LY294002 (ISO)

methapyrilene (EXP)

methyl methanesulfonate (ISO)

mifepristone (ISO)

N-nitrosodiethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nimesulide (EXP)

O-methyleugenol (ISO)

obeticholic acid (ISO)

olanzapine (ISO)

oxycodone (EXP)

p-toluidine (EXP)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

quercetin (ISO)

rifampicin (ISO)

rotenone (EXP)

sodium arsenite (ISO)

streptozocin (ISO)

T-2 toxin (EXP)

tert-butyl ethyl ether (EXP)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thioacetamide (EXP)

triphenyl phosphate (EXP)

ursodeoxycholic acid (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

zinc atom (EXP,ISO)

zinc(0) (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid biosynthetic process (ISO)

bile acid metabolic process (IBA,IMP,ISO)

establishment of localization in cell (ISO)

fatty acid transport (ISO)

ketone body biosynthetic process (ISO)

long-chain fatty acid import across plasma membrane (ISO)

long-chain fatty acid import into cell (IBA)

long-chain fatty acid metabolic process (IBA)

triglyceride mobilization (ISO)

very long-chain fatty acid metabolic process (ISO)

Cellular Component

basal plasma membrane (ISO)

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IBA,ISO)

plasma membrane (IBA)

protein-containing complex (IDA)

Molecular Function

ATP binding (IEA)

cholate-CoA ligase activity (IDA,ISO)

fatty acid transmembrane transporter activity (ISO)

long-chain fatty acid transmembrane transporter activity (IBA,ISO,ISS)

long-chain fatty acid-CoA ligase activity (IBA)

protein binding (ISO)

protein-containing complex binding (IDA)

very long-chain fatty acid-CoA ligase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

bile acid biosynthetic pathway (IEA,ISO)

bile acid transport pathway (IEA)

cerebrotendinous xanthomatosis pathway (ISO)

congenital bile acid synthesis defect pathway (ISO)

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

familial hypercholanemia pathway (ISO)

primary bile acid biosynthetic pathway (IEA)

Zellweger syndrome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and expression of rat liver bile acid CoA ligase.	Falany CN, etal., J Lipid Res 2002 Dec;43(12):2062-71.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat liver bile acid CoA:amino acid N-acyltransferase: expression, characterization, and peroxisomal localization.	He D, etal., J Lipid Res. 2003 Dec;44(12):2242-9. Epub 2003 Sep 1.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Purification and characterization of a rat liver bile acid coenzyme A ligase from rat liver microsomes.	Wheeler JB, etal., Arch Biochem Biophys. 1997 Dec 1;348(1):15-24.

Additional References at PubMed

PMID:9671728	PMID:10479480	PMID:10749848	PMID:11980911	PMID:12477932	PMID:15489334	PMID:16618416	PMID:16618417	PMID:20530735

Genomics

Comparative Map Data

Slc27a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	82,688,742 - 82,699,335 (-)	NCBI		GRCr8
mRatBN7.2	1	73,616,556 - 73,627,149 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	73,616,564 - 73,627,172 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	78,996,966 - 79,007,611 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	87,561,304 - 87,571,949 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	80,752,046 - 80,762,691 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	65,576,599 - 65,587,192 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	65,576,535 - 65,587,186 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	66,387,832 - 66,398,425 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	72,924,630 - 72,935,223 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	73,002,740 - 73,013,332 (+)	NCBI
Celera	1	60,212,177 - 60,222,770 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

SLC27A5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	58,498,333 - 58,511,992 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	58,479,512 - 58,512,413 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	59,009,700 - 59,023,359 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	63,701,517 - 63,715,161 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	63,701,517 - 63,715,157	NCBI
Celera	19	56,053,816 - 56,067,542 (-)	NCBI		Celera
Cytogenetic Map	19	q13.43	NCBI
HuRef	19	55,319,377 - 55,333,864 (-)	NCBI		HuRef
CHM1_1	19	59,003,732 - 59,017,394 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	61,594,402 - 61,607,985 (-)	NCBI		T2T-CHM13v2.0

Slc27a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	12,722,273 - 12,732,119 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	12,722,273 - 12,732,119 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	12,988,346 - 12,998,192 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	12,988,346 - 12,998,192 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	13,573,695 - 13,583,541 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	11,888,532 - 11,898,329 (-)	NCBI		MGSCv36	mm8
Celera	7	10,613,981 - 10,626,137 (-)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	7.71	NCBI

Slc27a5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955584	1,112,117 - 1,121,323 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955584	1,112,387 - 1,121,500 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC27A5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	64,768,032 - 64,788,131 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	66,555,906 - 66,576,003 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	55,507,455 - 55,520,448 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	64,329,567 - 64,342,630 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	64,329,567 - 64,342,630 (-)	Ensembl	panpan1.1		panPan2

SLC27A5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	99,435,140 - 99,438,388 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	99,833,542 - 99,842,039 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	100,048,410 - 100,056,905 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	100,041,887 - 100,056,901 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	99,693,751 - 99,702,249 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	99,406,581 - 99,415,077 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	100,161,220 - 100,169,717 (+)	NCBI		UU_Cfam_GSD_1.0

Slc27a5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	218,019,774 - 218,029,145 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937062	89,664 - 98,113 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937062	90,217 - 98,562 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC27A5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,065,830 - 63,075,202 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	63,068,880 - 63,075,246 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SLC27A5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	50,782,713 - 50,793,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	50,781,544 - 50,792,515 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	4,088,423 - 4,092,128 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc27a5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	84,552 - 92,556 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	84,456 - 92,706 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc27a5
80 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000026575
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

BE107935

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	73,616,603 - 73,616,779 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	65,586,969 - 65,587,144	NCBI	Rnor6.0
Rnor_5.0	1	66,398,202 - 66,398,377	UniSTS	Rnor5.0
RGSC_v3.4	1	72,935,000 - 72,935,175	UniSTS	RGSC3.4
Celera	1	60,222,547 - 60,222,722	UniSTS
RH 3.4 Map	1	765.69	UniSTS
Cytogenetic Map	1	q21	UniSTS

Genetic Models

This gene Slc27a5 is modified in the following models/strains:

FHH-Slc27a5^m1Mcwi BN-Slc27a5^m2Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	11	19	98	91	89	59	24	59	6	181	65	78	42	56	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF242189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026575 ⟹ ENSRNOP00000026574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	73,616,564 - 73,627,172 (-)	Ensembl
Rnor_6.0 Ensembl	1	65,576,535 - 65,587,186 (+)	Ensembl

RefSeq Acc Id:

NM_024143 ⟹ NP_077057

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	82,688,742 - 82,699,335 (-)	NCBI
mRatBN7.2	1	73,616,556 - 73,627,149 (-)	NCBI
Rnor_6.0	1	65,576,599 - 65,587,192 (+)	NCBI
Rnor_5.0	1	66,387,832 - 66,398,425 (+)	NCBI
RGSC_v3.4	1	72,924,630 - 72,935,223 (+)	RGD
Celera	1	60,212,177 - 60,222,770 (+)	RGD

Sequence:

show sequence

CTCAGAGCTGAGACTACCCGCTCTCAGCTACTTCACAAAGAGCCAGTGCCATGGGTGTTTGGAA
GAAACTAACCTTCTTGCTGCTGTCGCTGCTTCTCCTGGTTGGCCTGGGGCAGCCCCTGTGGCCA
GCAGCTACGGCTCTGGCCCTGCGTTGGTTCCTGGGAGACCCCACGTGCTTTGTGCTGCTTGGCT
TGGCATTCCTGGGCAGACCCTGGATCAGCTCCTGGATACCCCACTGGCTGAGCCTGGCAGCAGC
AGCTCTCACATTATCCCTATTGCCTCCACGGCCACCCCCAGAACTTCGCTGGCTGCACAAAGAT
GTGGCCTTCGCCTTCAAGTTGCTTTTCTATGGCCTGAACCTCAGGCGACGCCTTAACAGACATC
CTCCAGAACTCTTTGTGGATGCTTTAGAGCAGCAAGCACAGGCCCGGCCTGACCAGGTGGCCTT
GGTGTGTACTGGGTCTGAGGGCTGCTCAATCACAAATAGGGAGCTGAATGCCAAGGCCTGTCAA
GCAGCATGGGCCCTGAAAGCAAAGCTGAAGGAAGCCACAATCCAGGAGGACAAAGGCGCTACTG
CTATTTTAGTACTCCCGTCCAAGTCCATTTCTGCTCTGAGTGTGTTTCTGGGTTTGGCCAAGTT
GGGCTGCCCTGTGGCCTGGATCAATCCACACAGTCGAGGAATGCCCTTGCTACACTCTGTGCAG
AGCTCTGGGGCTAGTGTGCTGATTGTGGATCCAGACCTCCAGGAGAACCTGGAAGAAGTCCTTC
CCAAGCTGCTAGCTGAGAACATTCGATGCTTCTACCTTGGCCACAGCTCACCCACTCCGGGCGT
AGAGGCTCTAGGAGCTGCCCTGGACGCTGCACCTTCTGACCCAGTGCCTGCCAAGCTTCGTGCT
AATATAAAGTGGAAATCCCCAGCCATATTCATCTATACTTCAGGGACCACTGGACTTCCAAAGC
CAGCCATCCTATCACATGAGCGGGTCATACAAATGAGTAACGTGCTGTCCTTTTGTGGGAGAAC
AGCTGATGATGTGGTCTACAATGTTCTACCTCTGTACCATTCGATGGGGCTTGTCCTTGGAGTC
CTCGGCTGCTTACAACTTGGAGCCACCTGTGTCCTGGCCCCCAAGTTCTCTGCTTCCCGATACT
GGGCTGAGTGCCGGCAGTACAGTGTGACAGTGGTCCTGTATGTGGGTGAAGTCCTGCGATACTT
GTGTAATGTCCCAGGGCAACCAGAAGACAAGAAACATACAGTGCGGTTCGCATTGGGCAATGGA
CTTCGGGCAGACGTGTGGGAAAACTTCCAGCAACGATTTGGTCCCATTCAGATCTGGGAACTCT
ACGGCTCCACAGAGGGCAACGTGGGCTTAATGAACTATGTGGGGCACTGCGGGGCTGTGGGCAA
GACCAGCTGCTTCATTCGAATGCTGACTCCCCTTGAGCTTGTACAGTTTGACATAGAGACGGCA
GAGCCTGTGAGGGACAAACAGGGTTTTTGCATCCCTGTGGAGACAGGAAAGCCAGGACTTCTTT
TGACCAAGATTCGAAAGAACCAACCCTTCCTGGGCTACCGTGGTTCCCAGGATGAAACCAAGCG
GAAACTGGTTGCGAACGTACGGCAAGTAGGAGACCTCTACTACAACACAGGGGATGTGCTGGCC
TTGGACCAGGAAGGCTTCTTCTACTTCCGAGACCGCCTTGGTGACACCTTCCGGTGGAAGGGTG
AAAATGTATCCACTCGAGAGGTGGAGGGTGTGTTGTCTATCCTAGACTTCCTAGAGGAAGTCAA
TGTCTATGGTGTGACTGTGCCAGGGTGTGAGGGTAAGGTTGGCATGGCTGCTGTGAAACTGGCT
CCTGGGAAGACTTTTGATGGGCAGAAGCTCTACCAGCATGTCCGCTCCTGGCTCCCTGCCTATG
CCACACCTCATTTCATCCGTATCCAGGACTCCCTGGAGATCACAAACACCTACAAGCTAGTGAA
GTCACAACTGGCGCGTGAGGGTTTTGATGTGGGGGTCATTGCTGACCCTCTCTACATACTGGAC
AACAAGGCCGAAACCTTCCGGAGTCTGATGCCAGATGTGTACCAGGCTGTGTGTGAAGGAACCT
GGAAGCTCTGATCACCTAGCCAAGTGGAAGGCTATCCAAAAGTGTGGAAATCGGAAATCGACAC
TAGTCAGCTTCACAAAGTGGTCAGGGTTCCAGATGTCCATGGCCCAGTAGTACTTAGAGAATAA
ACTTGAATGTGTATATAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077057	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG09770	(Get FASTA)	NCBI Sequence Viewer
	AAH91147	(Get FASTA)	NCBI Sequence Viewer
	EDL75770	(Get FASTA)	NCBI Sequence Viewer
	EDL75771	(Get FASTA)	NCBI Sequence Viewer
	EDL75772	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026574.2
	ENSRNOP00055022462
	ENSRNOP00060034261
	ENSRNOP00065044695
GenBank Protein	Q9ES38	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_077057 ⟸ NM_024143

- UniProtKB:

Q9ES38 (UniProtKB/Swiss-Prot), A6KQM0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGVWKKLTFLLLSLLLLVGLGQPLWPAATALALRWFLGDPTCFVLLGLAFLGRPWISSWIPHWL
SLAAAALTLSLLPPRPPPELRWLHKDVAFAFKLLFYGLNLRRRLNRHPPELFVDALEQQAQARP
DQVALVCTGSEGCSITNRELNAKACQAAWALKAKLKEATIQEDKGATAILVLPSKSISALSVFL
GLAKLGCPVAWINPHSRGMPLLHSVQSSGASVLIVDPDLQENLEEVLPKLLAENIRCFYLGHSS
PTPGVEALGAALDAAPSDPVPAKLRANIKWKSPAIFIYTSGTTGLPKPAILSHERVIQMSNVLS
FCGRTADDVVYNVLPLYHSMGLVLGVLGCLQLGATCVLAPKFSASRYWAECRQYSVTVVLYVGE
VLRYLCNVPGQPEDKKHTVRFALGNGLRADVWENFQQRFGPIQIWELYGSTEGNVGLMNYVGHC
GAVGKTSCFIRMLTPLELVQFDIETAEPVRDKQGFCIPVETGKPGLLLTKIRKNQPFLGYRGSQ
DETKRKLVANVRQVGDLYYNTGDVLALDQEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDF
LEEVNVYGVTVPGCEGKVGMAAVKLAPGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNT
YKLVKSQLAREGFDVGVIADPLYILDNKAETFRSLMPDVYQAVCEGTWKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000026574 ⟸ ENSRNOT00000026575

Protein Domains

AMP-binding enzyme C-terminal AMP-dependent synthetase/ligase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ES38-F1-model_v2	AlphaFold	Q9ES38	1-690	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689674

Promoter ID:

EPDNEW_R199

Type:

initiation region

Name:

Slc27a5_1

Description:

solute carrier family 27 member 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	65,576,595 - 65,576,655	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708535	AgrOrtholog
BioCyc Gene	G2FUF-60701	BioCyc
BioCyc Pathway	PWY-6061 [bile acid biosynthesis, neutral pathway]	BioCyc
BioCyc Pathway Image	PWY-6061	BioCyc
Ensembl Genes	ENSRNOG00000019626	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055016476	UniProtKB/Swiss-Prot
	ENSRNOG00060023871	UniProtKB/Swiss-Prot
	ENSRNOG00065031529	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026575.5	UniProtKB/Swiss-Prot
	ENSRNOT00055027941	UniProtKB/Swiss-Prot
	ENSRNOT00060041356	UniProtKB/Swiss-Prot
	ENSRNOT00065054328	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.300.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.12780	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7370589	IMAGE-MGC_LOAD
InterPro	AMP-bd_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-bd_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-binding_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-dep_Synth/Lig	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-dep_Synthh-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79111	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108681	IMAGE-MGC_LOAD
NCBI Gene	79111	ENTREZGENE
PANTHER	BILE ACYL-COA SYNTHETASE	UniProtKB/TrEMBL
	LONG-CHAIN FATTY ACID TRANSPORT PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR43107:SF4	UniProtKB/Swiss-Prot
Pfam	AMP-binding	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-binding_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc27a5	PhenoGen
PROSITE	AMP_BINDING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019626	RatGTEx
	ENSRNOG00055016476	RatGTEx
	ENSRNOG00060023871	RatGTEx
	ENSRNOG00065031529	RatGTEx
Superfamily-SCOP	Acetyl-CoA synthetase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6KQM0	ENTREZGENE, UniProtKB/TrEMBL
	A6KQM1_RAT	UniProtKB/TrEMBL
	A6KQM2_RAT	UniProtKB/TrEMBL
	Q9ES38	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc27a5	solute carrier family 27 member 5	Slc27a5	solute carrier family 27 (fatty acid transporter), member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Slc27a5	solute carrier family 27 (fatty acid transporter), member 5		bile acid CoA ligase	Name updated	1299863	APPROVED
2004-09-10	Slc27a5	bile acid CoA ligase	LOC79111		Symbol and Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways