Symbol:
Fstl1
Name:
follistatin-like 1
RGD ID:
68955
Description:
Predicted to enable calcium ion binding activity and heparin binding activity. Predicted to be involved in several processes, including endothelial cell differentiation; endothelial cell migration; and regulation of BMP signaling pathway. Predicted to act upstream of or within hematopoietic stem cell homeostasis. Predicted to be active in extracellular region. Orthologous to human FSTL1 (follistatin like 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
follistatin-like; follistatin-like protein 1; follistatin-related protein; follistatin-related protein 1; follistatin-related protein precursor; Frp; Fstl; MGC93410
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FSTL1 (follistatin like 1)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fstl1 (follistatin-like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fstl1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FSTL1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FSTL1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fstl1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FSTL1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FSTL1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fstl1 (follistatin like 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACTL6B (actin like 6B)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FSTL1 (follistatin like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fstl1 (follistatin-like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fstl1a (follistatin-like 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fstl1b (follistatin-like 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fstl1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 76,400,870 - 76,454,053 (-) NCBI GRCr8 mRatBN7.2 11 62,895,391 - 62,948,581 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 62,779,783 - 62,948,677 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 71,707,886 - 71,761,075 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 64,370,096 - 64,423,283 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 63,420,096 - 63,473,181 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 65,791,196 - 65,845,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 65,782,567 - 65,845,418 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 68,884,410 - 68,938,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 64,681,814 - 64,735,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 64,739,417 - 64,793,262 (-) NCBI Celera 11 62,393,441 - 62,446,724 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fstl1 Rat (1->4)-beta-D-glucan multiple interactions ISO Fstl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FSTL1 mRNA CTD PMID:36331819 Fstl1 Rat 1,2-dimethylhydrazine increases expression ISO Fstl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FSTL1 mRNA CTD PMID:22206623 Fstl1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of FSTL1 mRNA CTD PMID:25380136 Fstl1 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of FSTL1 mRNA CTD PMID:16079270 Fstl1 Rat 17beta-estradiol multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of FSTL1 mRNA CTD PMID:30165855 Fstl1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Fstl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FSTL1 mRNA CTD PMID:34747641 Fstl1 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Fstl1 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of FSTL1 mRNA] CTD PMID:18200517 Fstl1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Fstl1 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of FSTL1 mRNA CTD PMID:18200517 Fstl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Fstl1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Fstl1 Rat 2-butoxyethanol increases expression ISO Fstl1 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of FSTL1 mRNA CTD PMID:19812364 Fstl1 Rat 3,4-dichloroaniline decreases expression ISO FSTL1 (Homo sapiens) 6480464 3 and 4-dichloroaniline results in decreased expression of FSTL1 mRNA CTD PMID:24172598 Fstl1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FSTL1 mRNA CTD PMID:28628672 Fstl1 Rat 3-methylcholanthrene decreases expression ISO Fstl1 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of FSTL1 mRNA CTD PMID:20713471 Fstl1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of FSTL1 mRNA CTD PMID:25380136 Fstl1 Rat 4,4'-sulfonyldiphenol increases expression ISO Fstl1 (Mus musculus) 6480464 bisphenol S results in increased expression of FSTL1 mRNA CTD PMID:30951980 and PMID:39298647 Fstl1 Rat 4,4'-sulfonyldiphenol increases expression ISO FSTL1 (Homo sapiens) 6480464 bisphenol S results in increased expression of FSTL1 protein CTD PMID:34186270 Fstl1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO FSTL1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of FSTL1 gene CTD PMID:31601247 Fstl1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Fstl1 (Mus musculus) 6480464 Fenretinide results in decreased expression of FSTL1 mRNA CTD PMID:28973697 Fstl1 Rat 5-aza-2'-deoxycytidine increases expression ISO FSTL1 (Homo sapiens) 6480464 Decitabine results in increased expression of FSTL1 mRNA CTD PMID:19194470 Fstl1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of FSTL1 mRNA CTD PMID:30047161 Fstl1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of FSTL1 mRNA CTD PMID:28959563 Fstl1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of FSTL1 mRNA CTD PMID:22484513 Fstl1 Rat aflatoxin B1 decreases methylation ISO FSTL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FSTL1 gene CTD PMID:27153756 Fstl1 Rat aflatoxin B1 increases expression ISO FSTL1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of FSTL1 mRNA CTD PMID:27153756 Fstl1 Rat all-trans-retinoic acid increases expression ISO FSTL1 (Homo sapiens) 6480464 Tretinoin results in increased expression of FSTL1 mRNA CTD PMID:23724009 Fstl1 Rat all-trans-retinoic acid multiple interactions ISO Fstl1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of FSTL1 mRNA and [bisphenol F co-treated with Tretinoin] results in decreased expression of FSTL1 mRNA CTD PMID:30951980 Fstl1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of FSTL1 mRNA CTD PMID:38685447 Fstl1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of FSTL1 mRNA CTD PMID:30047161 Fstl1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FSTL1 mRNA CTD PMID:16483693 Fstl1 Rat aristolochic acid A decreases expression ISO FSTL1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of FSTL1 mRNA CTD PMID:33212167 Fstl1 Rat atrazine increases expression ISO FSTL1 (Homo sapiens) 6480464 Atrazine results in increased expression of FSTL1 mRNA CTD PMID:22378314 Fstl1 Rat azoxystrobin decreases expression ISO FSTL1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of FSTL1 mRNA CTD PMID:33512557 Fstl1 Rat benzo[a]pyrene diol epoxide I increases expression ISO FSTL1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Fstl1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of FSTL1 mRNA CTD PMID:18164116 Fstl1 Rat beta-naphthoflavone decreases expression ISO FSTL1 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of FSTL1 mRNA CTD PMID:32858204 Fstl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Fstl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of FSTL1 mRNA CTD PMID:34319233 Fstl1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FSTL1 mRNA CTD PMID:25181051 Fstl1 Rat bisphenol A increases expression ISO Fstl1 (Mus musculus) 6480464 bisphenol A results in increased expression of FSTL1 mRNA CTD PMID:30951980 Fstl1 Rat bisphenol A decreases expression ISO FSTL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FSTL1 mRNA and bisphenol A results in decreased expression of FSTL1 protein CTD PMID:29275510 and PMID:34186270 Fstl1 Rat bisphenol A multiple interactions ISO Fstl1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of FSTL1 mRNA CTD PMID:30951980 Fstl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FSTL1 mRNA CTD PMID:30816183 more ... Fstl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FSTL1 protein CTD PMID:28285737 Fstl1 Rat bisphenol A multiple interactions EXP 6480464 Sodium Selenite inhibits the reaction [bisphenol A results in increased expression of FSTL1 protein] CTD PMID:28285737 Fstl1 Rat bisphenol A multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FSTL1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FSTL1 mRNA CTD PMID:28628672 and PMID:31601247 Fstl1 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of FSTL1 mRNA CTD PMID:27567155 Fstl1 Rat Bisphenol B increases expression ISO FSTL1 (Homo sapiens) 6480464 bisphenol B results in increased expression of FSTL1 protein CTD PMID:34186270 Fstl1 Rat bisphenol F increases expression ISO Fstl1 (Mus musculus) 6480464 bisphenol F results in increased expression of FSTL1 mRNA CTD PMID:30951980 Fstl1 Rat bisphenol F increases expression ISO FSTL1 (Homo sapiens) 6480464 bisphenol F results in increased expression of FSTL1 protein CTD PMID:34186270 Fstl1 Rat bisphenol F multiple interactions ISO Fstl1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of FSTL1 mRNA CTD PMID:30951980 Fstl1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of FSTL1 mRNA CTD PMID:24136188 Fstl1 Rat cadmium dichloride multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in decreased expression of FSTL1 mRNA CTD PMID:19840844 Fstl1 Rat calciol increases expression ISO Fstl1 (Mus musculus) 6480464 Cholecalciferol results in increased expression of FSTL1 mRNA CTD PMID:17170073 Fstl1 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FSTL1 protein] more ... CTD PMID:22150557 Fstl1 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of FSTL1 protein CTD PMID:22150557 Fstl1 Rat carbon nanotube decreases expression ISO Fstl1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of FSTL1 mRNA CTD PMID:25620056 Fstl1 Rat carbon nanotube increases expression ISO Fstl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Fstl1 Rat CGP 52608 multiple interactions ISO FSTL1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FSTL1 gene] CTD PMID:28238834 Fstl1 Rat chlordecone decreases expression ISO Fstl1 (Mus musculus) 6480464 Chlordecone results in decreased expression of FSTL1 mRNA CTD PMID:33711761 Fstl1 Rat choline multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FSTL1 mRNA CTD PMID:20938992 Fstl1 Rat cisplatin increases expression ISO Fstl1 (Mus musculus) 6480464 Cisplatin results in increased expression of FSTL1 mRNA CTD PMID:21151649 Fstl1 Rat cisplatin multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of FSTL1 mRNA CTD PMID:27392435 Fstl1 Rat cisplatin multiple interactions ISO Fstl1 (Mus musculus) 6480464 FSTL1 protein inhibits the reaction [Cisplatin results in increased expression of IL1B protein] CTD PMID:20861081 Fstl1 Rat clofibrate decreases expression ISO Fstl1 (Mus musculus) 6480464 Clofibrate results in decreased expression of FSTL1 mRNA CTD PMID:17585979 Fstl1 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of FSTL1 mRNA CTD PMID:30047161 Fstl1 Rat clozapine multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of FSTL1 protein CTD PMID:34122009 Fstl1 Rat cobalt dichloride decreases secretion ISO FSTL1 (Homo sapiens) 6480464 cobaltous chloride results in decreased secretion of FSTL1 protein CTD PMID:22079246 Fstl1 Rat copper atom multiple interactions ISO Fstl1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of FSTL1 mRNA CTD PMID:15467011 Fstl1 Rat copper atom multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of FSTL1 mRNA CTD PMID:24690739 Fstl1 Rat copper(0) multiple interactions ISO Fstl1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of FSTL1 mRNA CTD PMID:15467011 Fstl1 Rat copper(0) multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of FSTL1 mRNA CTD PMID:24690739 Fstl1 Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of FSTL1 mRNA CTD PMID:26577399 Fstl1 Rat Cuprizon multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of FSTL1 protein CTD PMID:34122009 Fstl1 Rat curcumin multiple interactions ISO Fstl1 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of FSTL1 mRNA] CTD PMID:18200517 Fstl1 Rat cyclosporin A decreases expression ISO FSTL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FSTL1 mRNA CTD PMID:20106945 and PMID:27989131 Fstl1 Rat DDE increases expression ISO FSTL1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of FSTL1 mRNA CTD PMID:38568856 Fstl1 Rat deguelin decreases expression ISO FSTL1 (Homo sapiens) 6480464 deguelin results in decreased expression of FSTL1 mRNA CTD PMID:33512557 Fstl1 Rat dexamethasone multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FSTL1 mRNA CTD PMID:28628672 Fstl1 Rat disodium selenite multiple interactions EXP 6480464 Sodium Selenite inhibits the reaction [bisphenol A results in increased expression of FSTL1 protein] CTD PMID:28285737 Fstl1 Rat disulfiram multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of FSTL1 mRNA CTD PMID:24690739 Fstl1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of FSTL1 mRNA CTD PMID:25152437 Fstl1 Rat diuron decreases expression ISO FSTL1 (Homo sapiens) 6480464 Diuron metabolite results in decreased expression of FSTL1 mRNA CTD PMID:24172598 Fstl1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of FSTL1 mRNA CTD PMID:21551480 Fstl1 Rat dorsomorphin multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fstl1 Rat doxorubicin affects expression ISO FSTL1 (Homo sapiens) 6480464 Doxorubicin affects the expression of FSTL1 mRNA CTD PMID:29803840 Fstl1 Rat entinostat decreases expression ISO FSTL1 (Homo sapiens) 6480464 entinostat results in decreased expression of FSTL1 mRNA CTD PMID:26272509 Fstl1 Rat entinostat multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FSTL1 mRNA CTD PMID:27188386 Fstl1 Rat ethanol multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of FSTL1 mRNA CTD PMID:29432896 Fstl1 Rat ethanol affects splicing ISO Fstl1 (Mus musculus) 6480464 Ethanol affects the splicing of FSTL1 mRNA CTD PMID:30319688 Fstl1 Rat folic acid multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FSTL1 mRNA CTD PMID:20938992 Fstl1 Rat fonofos increases methylation ISO FSTL1 (Homo sapiens) 6480464 Fonofos results in increased methylation of FSTL1 promoter CTD PMID:22847954 Fstl1 Rat fulvestrant increases methylation ISO FSTL1 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of FSTL1 gene CTD PMID:31601247 Fstl1 Rat fulvestrant multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of FSTL1 gene CTD PMID:31601247 Fstl1 Rat furan increases expression EXP 6480464 furan results in increased expression of FSTL1 mRNA CTD PMID:27387713 Fstl1 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of FSTL1 gene CTD PMID:27387713 Fstl1 Rat genistein decreases expression ISO Fstl1 (Mus musculus) 6480464 Genistein results in decreased expression of FSTL1 mRNA CTD PMID:21810550 Fstl1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of FSTL1 mRNA CTD PMID:24395379 Fstl1 Rat glyphosate increases expression ISO Fstl1 (Mus musculus) 6480464 Glyphosate results in increased expression of FSTL1 mRNA CTD PMID:35897073 Fstl1 Rat griseofulvin affects expression ISO Fstl1 (Mus musculus) 6480464 Griseofulvin affects the expression of FSTL1 mRNA CTD PMID:12735108 Fstl1 Rat indometacin multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FSTL1 mRNA CTD PMID:28628672 Fstl1 Rat inulin multiple interactions ISO Fstl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FSTL1 mRNA CTD PMID:36331819 Fstl1 Rat L-methionine multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FSTL1 mRNA CTD PMID:20938992 Fstl1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of FSTL1 mRNA CTD PMID:30047161 Fstl1 Rat methotrexate affects response to substance ISO FSTL1 (Homo sapiens) 6480464 FSTL1 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Fstl1 Rat methylmercury chloride increases expression ISO FSTL1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of FSTL1 mRNA CTD PMID:28001369 Fstl1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in decreased expression of FSTL1 mRNA more ... CTD PMID:19840844 Fstl1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of FSTL1 mRNA CTD PMID:18164116 Fstl1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of FSTL1 mRNA CTD PMID:25380136 Fstl1 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FSTL1 protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of FSTL1 protein] CTD PMID:22150557 Fstl1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of FSTL1 mRNA CTD PMID:24136188 Fstl1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of FSTL1 mRNA CTD PMID:24136188 Fstl1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of FSTL1 mRNA and nitrofen results in decreased expression of FSTL1 protein CTD PMID:28188034 Fstl1 Rat okadaic acid multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in decreased expression of FSTL1 mRNA CTD PMID:19840844 Fstl1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FSTL1 mRNA CTD PMID:25729387 Fstl1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of FSTL1 mRNA CTD PMID:25729387 Fstl1 Rat paracetamol increases expression ISO Fstl1 (Mus musculus) 6480464 Acetaminophen results in increased expression of FSTL1 mRNA CTD PMID:17585979 Fstl1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FSTL1 mRNA CTD PMID:33387578 Fstl1 Rat paracetamol decreases expression ISO FSTL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of FSTL1 mRNA CTD PMID:29067470 Fstl1 Rat paracetamol affects expression ISO Fstl1 (Mus musculus) 6480464 Acetaminophen affects the expression of FSTL1 mRNA CTD PMID:17562736 Fstl1 Rat paraquat multiple interactions ISO Fstl1 (Mus musculus) 6480464 plant extract more ... CTD PMID:26758514 Fstl1 Rat paraquat increases expression ISO Fstl1 (Mus musculus) 6480464 Paraquat results in increased expression of FSTL1 mRNA and Paraquat results in increased expression of FSTL1 protein CTD PMID:26758514 Fstl1 Rat parathion increases methylation ISO FSTL1 (Homo sapiens) 6480464 Parathion results in increased methylation of FSTL1 promoter CTD PMID:22847954 Fstl1 Rat perfluorohexanesulfonic acid increases expression ISO Fstl1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of FSTL1 mRNA CTD PMID:37995155 Fstl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fstl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FSTL1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FSTL1 mRNA CTD PMID:36331819 Fstl1 Rat perfluorooctanoic acid decreases expression ISO FSTL1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of FSTL1 mRNA CTD PMID:25868421 Fstl1 Rat phenobarbital affects expression ISO FSTL1 (Homo sapiens) 6480464 Phenobarbital affects the expression of FSTL1 mRNA CTD PMID:19159669 Fstl1 Rat phenylmercury acetate increases expression ISO FSTL1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of FSTL1 mRNA CTD PMID:26272509 Fstl1 Rat phenylmercury acetate multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FSTL1 mRNA CTD PMID:27188386 Fstl1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Fstl1 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of FSTL1 mRNA CTD PMID:19840844 Fstl1 Rat picoxystrobin decreases expression ISO FSTL1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of FSTL1 mRNA CTD PMID:33512557 Fstl1 Rat pirinixic acid multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of FSTL1 mRNA CTD PMID:19710929 Fstl1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of FSTL1 mRNA CTD PMID:19162173 Fstl1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of FSTL1 mRNA CTD PMID:28374803 Fstl1 Rat rotenone decreases expression ISO FSTL1 (Homo sapiens) 6480464 Rotenone results in decreased expression of FSTL1 mRNA CTD PMID:33512557 Fstl1 Rat SB 431542 multiple interactions ISO FSTL1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fstl1 Rat sodium arsenite decreases expression ISO Fstl1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FSTL1 mRNA CTD PMID:18812580 Fstl1 Rat sodium arsenite decreases expression ISO FSTL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FSTL1 mRNA CTD PMID:34032870 Fstl1 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of FSTL1 protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of FSTL1 protein] CTD PMID:22150557 Fstl1 Rat sunitinib decreases expression ISO FSTL1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of FSTL1 mRNA CTD PMID:31533062 Fstl1 Rat temozolomide increases expression ISO FSTL1 (Homo sapiens) 6480464 Temozolomide results in increased expression of FSTL1 mRNA CTD PMID:31758290 Fstl1 Rat terbufos increases methylation ISO FSTL1 (Homo sapiens) 6480464 terbufos results in increased methylation of FSTL1 promoter CTD PMID:22847954 Fstl1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of FSTL1 mRNA CTD PMID:16239168 Fstl1 Rat tetrachloromethane increases expression ISO Fstl1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FSTL1 mRNA CTD PMID:27339419 more ... Fstl1 Rat thiram decreases expression ISO FSTL1 (Homo sapiens) 6480464 Thiram results in decreased expression of FSTL1 mRNA CTD PMID:38568856 Fstl1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of FSTL1 mRNA CTD PMID:25729387 Fstl1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FSTL1 mRNA CTD PMID:25729387 Fstl1 Rat trichostatin A increases expression ISO FSTL1 (Homo sapiens) 6480464 trichostatin A results in increased expression of FSTL1 mRNA CTD PMID:24935251 Fstl1 Rat triphenyl phosphate affects expression ISO FSTL1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FSTL1 mRNA CTD PMID:37042841 Fstl1 Rat troglitazone increases expression ISO Fstl1 (Mus musculus) 6480464 troglitazone results in increased expression of FSTL1 mRNA CTD PMID:28973697 Fstl1 Rat valproic acid decreases expression ISO Fstl1 (Mus musculus) 6480464 Valproic Acid analog results in decreased expression of FSTL1 mRNA and Valproic Acid results in decreased expression of FSTL1 mRNA CTD PMID:21427059 Fstl1 Rat valproic acid increases expression ISO FSTL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FSTL1 mRNA CTD PMID:23179753 more ... Fstl1 Rat valproic acid decreases expression ISO FSTL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FSTL1 mRNA CTD PMID:29154799 Fstl1 Rat valproic acid affects expression ISO FSTL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of FSTL1 mRNA CTD PMID:25979313 Fstl1 Rat vancomycin decreases expression ISO Fstl1 (Mus musculus) 6480464 Vancomycin results in decreased expression of FSTL1 mRNA CTD PMID:18930951 Fstl1 Rat zoledronic acid increases expression ISO FSTL1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of FSTL1 mRNA CTD PMID:24714768
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 3,4-dichloroaniline (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) atrazine (ISO) azoxystrobin (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (ISO) calciol (ISO) capsaicin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) clotrimazole (EXP) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP,ISO) curcumin (ISO) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dexamethasone (ISO) disodium selenite (EXP) disulfiram (ISO) diuron (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) fonofos (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) glycidol (EXP) glyphosate (ISO) griseofulvin (ISO) indometacin (ISO) inulin (ISO) L-methionine (ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) naproxen (EXP) nefazodone (EXP) nimesulide (EXP) nitrofen (EXP) okadaic acid (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pirinixic acid (EXP,ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenite (ISO) sumatriptan (EXP) sunitinib (ISO) temozolomide (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vancomycin (ISO) zoledronic acid (ISO)
1.
Characterization of rat follistatin-related gene: effects of estrous cycle stage and pregnancy on its messenger RNA expression in rat reproductive tissues.
Arai KY, etal., Biol Reprod 2003 Jan;68(1):199-206.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.
Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Regulation of FLRG expression in rat primary astroglial cells and injured brain tissue by transforming growth factor-beta 1 (TGF-beta 1).
Zhang G, etal., J Neurosci Res 2003 Apr 1;72(1):33-45.
11.
Characterization of a rat C6 glioma-secreted follistatin-related protein (FRP). Cloning and sequence of the human homologue.
Zwijsen A, etal., Eur J Biochem 1994 Nov 1;225(3):937-46.
Fstl1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 76,400,870 - 76,454,053 (-) NCBI GRCr8 mRatBN7.2 11 62,895,391 - 62,948,581 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 62,779,783 - 62,948,677 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 71,707,886 - 71,761,075 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 64,370,096 - 64,423,283 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 63,420,096 - 63,473,181 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 65,791,196 - 65,845,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 65,782,567 - 65,845,418 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 68,884,410 - 68,938,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 64,681,814 - 64,735,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 64,739,417 - 64,793,262 (-) NCBI Celera 11 62,393,441 - 62,446,724 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
FSTL1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 120,392,293 - 120,450,992 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 120,392,293 - 120,451,016 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 120,111,140 - 120,169,839 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 121,595,816 - 121,652,515 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 121,595,816 - 121,652,515 NCBI Celera 3 118,522,464 - 118,579,350 (-) NCBI Celera Cytogenetic Map 3 q13.33 NCBI HuRef 3 117,488,896 - 117,545,793 (-) NCBI HuRef CHM1_1 3 120,076,707 - 120,133,627 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 123,111,839 - 123,170,569 (-) NCBI T2T-CHM13v2.0
Fstl1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 37,597,417 - 37,656,878 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 37,597,235 - 37,656,876 (+) Ensembl GRCm39 Ensembl GRCm38 16 37,777,055 - 37,836,516 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 37,776,873 - 37,836,514 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 37,777,141 - 37,836,602 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 37,696,294 - 37,755,755 (+) NCBI MGSCv36 mm8 Celera 16 38,184,966 - 38,244,699 (+) NCBI Celera Cytogenetic Map 16 B3 NCBI cM Map 16 26.48 NCBI
Fstl1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 19,952,853 - 20,004,241 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 19,952,823 - 20,003,832 (-) NCBI ChiLan1.0 ChiLan1.0
FSTL1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 118,363,612 - 118,419,277 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 118,368,390 - 118,423,861 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 117,508,772 - 117,564,254 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 Ensembl 3 124,422,968 - 124,475,431 (-) Ensembl panpan1.1 panPan2
FSTL1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 23,892,317 - 23,914,406 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 23,894,573 - 23,933,779 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 23,919,531 - 23,972,261 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 24,129,955 - 24,182,735 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 24,129,947 - 24,183,502 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 23,930,929 - 23,983,640 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 23,971,619 - 24,024,230 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 24,535,350 - 24,588,071 (-) NCBI UU_Cfam_GSD_1.0
Fstl1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 130,335,041 - 130,388,800 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936536 7,126,966 - 7,187,269 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936536 7,132,369 - 7,186,951 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FSTL1 (Sus scrofa - pig)
FSTL1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 60,371,309 - 60,427,259 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 60,371,554 - 60,428,764 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 105,887,988 - 105,942,526 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fstl1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 33 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000003721 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
RH138069
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 62,909,268 - 62,909,484 (+) MAPPER mRatBN7.2 Rnor_6.0 11 65,806,070 - 65,806,285 NCBI Rnor6.0 Rnor_5.0 11 68,899,283 - 68,899,498 UniSTS Rnor5.0 RGSC_v3.4 11 64,696,162 - 64,696,377 UniSTS RGSC3.4 Celera 11 62,407,319 - 62,407,534 UniSTS RH 3.4 Map 11 492.9 UniSTS Cytogenetic Map 11 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003721 ⟹ ENSRNOP00000003721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,885,835 - 62,917,459 (-) Ensembl Rnor_6.0 Ensembl 11 65,782,567 - 65,814,601 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091057 ⟹ ENSRNOP00000072839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,895,378 - 62,948,575 (-) Ensembl Rnor_6.0 Ensembl 11 65,792,207 - 65,845,418 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097784 ⟹ ENSRNOP00000077559
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,779,783 - 62,948,677 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103472 ⟹ ENSRNOP00000095289
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,894,395 - 62,948,354 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110627 ⟹ ENSRNOP00000077415
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,779,783 - 62,914,411 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114285 ⟹ ENSRNOP00000080660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,894,395 - 62,948,354 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117870 ⟹ ENSRNOP00000076465
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 62,898,199 - 62,948,354 (-) Ensembl
RefSeq Acc Id:
NM_024369 ⟹ NP_077345
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 76,400,870 - 76,454,053 (-) NCBI mRatBN7.2 11 62,895,391 - 62,948,581 (-) NCBI Rnor_6.0 11 65,792,192 - 65,845,375 (-) NCBI Rnor_5.0 11 68,884,410 - 68,938,352 (-) NCBI RGSC_v3.4 11 64,681,814 - 64,735,673 (-) RGD Celera 11 62,393,441 - 62,446,724 (-) RGD
Sequence:
CCTGGTGATCGGCGACGCTCCCACCTTCGCCTCCAACTCACTGCTTCCATCCTGCCCAGTGTCCTCTCGAGTCCCGGACCCGAGCACGATGTGGAAACGCTGGCTGGCGCTCGCGCTGGTGACCATCG CCCTGGTCCACGGCGAGGAGGAACAAAGAAGCAAATCCAAGATCTGCGCCAATGTGTTTTGTGGAGCTGGCCGGGAATGCGCCGTCACGGAGAAGGGGGAGCCAACGTGCCTCTGCATTGAGCAATGC AAACCTCACAAGAGGCCTGTGTGTGGCAGTAATGGCAAGACCTACCTCAACCATTGTGAACTTCACAGAGACGCCTGCCTCACTGGATCCAAGATCCAGGTTGATTATGATGGGCACTGCAAAGAAAA GAAGTCTGTGAGTCCATCCGCCAGCCCCGTTGTCTGCTATCAGGCTAACCGTGATGAGCTGCGGCGCCGGATCATCCAGTGGCTGGAAGCCGAGATCATTCCAGATGGCTGGTTCTCTAAAGGCAGTA ACTACAGTGAGATCCTAGACAAGTACTTTAAGAGCTTTGATAATGGTGACTCTCACCTGGACTCCAGCGAATTCCTGAAATTCGTGGAGCAGAATGAAACAGCCGTCAACATCACCGCTTACCCCAAT CAGGAGAACAACAAACTGCTCAGAGGCCTCTGTGTTGATGCCCTCATTGAACTGTCCGATGAGAACGCTGACTGGAAACTCAGCTTCCAAGAGTTCCTCAAGTGCCTCAACCCATCCTTCAACCCTCC TGAGAAGAAGTGCGCCCTGGAGGACGAAACCTATGCAGATGGAGCTGAGACCGAGGTGGACTGCAATCGCTGTGTCTGTTCCTGTGGACACTGGGTCTGCACAGCGATGACCTGTGATGGAAAGAATC AGAAGGGGGTCCAGACCCACACAGAGGAGGAGATGACGAGATATGCCCAGGAACTCCAGAAGCACCAGGGAACAGCAGAAAAGACCAAGAAGGTGAACACCAAAGAGATCTAAGAAGAGGCACGTAGC ACCTCATCTGGAACCCAGCACCTCCTCTTCAGCGCTAAGTCCAGTATACAGCGTCTGTGGCAATCACCGAATCACCAGTATTTGCTTGTACGGCAGCAAATCTTATTCTGTTTGTTTTGCAATAAAGG AAGTGAGGGTGGCTGGCTAGCCAGGGCAGGCAGGCCACAACTTTCACTTCTAGGAATGCTTTAAGAGACACTAAAGGGCACCTTGGGGCAGGAGGCGAGTATCCGGTTGGCAGAGGAGCAGAGGCAGG TCTGAATGAAACCTTTCTGGGGTCAGCTGTGAGGATACAACAGGAAAAGCATGTGATGTTAGGGGGAACACTGAGCTGGCCCTGCTGGAGGAAATAGGGGGAGCTTGGTGGGGAGGAACCCTGCTGCT TTGACCCTTGTCACCACTGTCATCATCCCAGATCTGCAGCAAATCTGCTTCTCCTTTTGATCCCCACAGTCACCTGCATACACAGTCGCCCCATTAGTTAGCTGTGTCCCTCAAACTTGGAGTTTCCT GAAGAGTGGGTTTGAATGATGCAAATACTTACGGACTTCAAGCGCCATGGAGACCTAACCAAAATTTTAAATACATTTCCCTTCTTTTTTTTTTTTTTTTTACCAAAGGTGCTATTTCTCTGTAAAAC ACTTTTTCTTTTTCGCAAGCTGACTTCATTCCTCAGTTATTACCATTATATTATTGTTGTTTTTTAATATTTCATCTTTTGACTAGATATTACGCTTTTGTGATTATTTTTTTTCATTAGTCTTACCA TTTCAGAAGTGAAGGTGAAAGGGGTTTGGGTGTTTCTCCAGGTACAGGGAACTCTAACACAGATGACCCCTTGCCCTGCCACATCCTAGACTGAACGCAGTCCAGAGCTACTGCACCCCCACCCATGG CTCCCACATGATCGGCTGGGTGCCACAAAGCACAAGAGGTCCCTCAGACAGAAGCCATGGGAAAAAAGCATCTTCATAGACAGTTGAGATCCAAAGAGTTGATTTGGTTTCATTTCTTGTGAGAAGTT CCAAGGACGGGATCCCAGGCCATGGCAGCCTGCCGTCATCTGTGGCTAACGGGCAGAGCGAGTCACTGCGGTCCTAGCTCTCCTATTTCTGGGTGTCCGTTTCCTTAGAGAACTGATTAGGAGGCATC TTGAGATTTAATCAATGGTAGTTTGTGGTTTAGGCAATCCTCAAGCCCCTTTGTTGTCCTGTTTTATGTGCATTGGACGTAACAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_077345 ⟸ NM_024369
- Peptide Label:
precursor
- UniProtKB:
Q62632 (UniProtKB/Swiss-Prot), A0A8I5Y6A3 (UniProtKB/TrEMBL)
- Sequence:
MWKRWLALALVTIALVHGEEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLE AEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCG HWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI
hide sequence
Ensembl Acc Id:
ENSRNOP00000072839 ⟸ ENSRNOT00000091057
Ensembl Acc Id:
ENSRNOP00000003721 ⟸ ENSRNOT00000003721
Ensembl Acc Id:
ENSRNOP00000076465 ⟸ ENSRNOT00000117870
Ensembl Acc Id:
ENSRNOP00000077415 ⟸ ENSRNOT00000110627
Ensembl Acc Id:
ENSRNOP00000077559 ⟸ ENSRNOT00000097784
Ensembl Acc Id:
ENSRNOP00000095289 ⟸ ENSRNOT00000103472
Ensembl Acc Id:
ENSRNOP00000080660 ⟸ ENSRNOT00000114285
RGD ID: 13698172
Promoter ID: EPDNEW_R8697
Type: initiation region
Name: Fstl1_1
Description: follistatin-like 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 65,845,382 - 65,845,442 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Fstl1
follistatin-like 1
Fstl
follistatin-like
Symbol and Name updated
1299863
APPROVED
2003-04-09
Fstl
follistatin-like
Frp
follistatin-related protein
Symbol and Name updated
629477
APPROVED
2002-06-10
Frp
follistatin-related protein
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_cellular_localization
may be secreted from astroglial cells
1299175
gene_expression
expressed in the ovary, uterus, testis, lung, adrenal gland, pituitary, kidney, small intestine, placenta and heart
1299174
gene_function
heparin-binding protein
1299173
gene_function
binds to activins and bone morphogenetic proteins
1299174
gene_process
may function as a negative regulator of cell growth
61515
gene_process
may play a role in the regulation of reproductive processes
1299174
gene_process
regulates activin A in brain wound healing in response to TGF-beta1
1299175
gene_protein
native molecular mass of 55-75,000 Da
1299173