Symbol:
Ppp2r2b
Name:
protein phosphatase 2, regulatory subunit B, beta
RGD ID:
631441
Description:
Predicted to enable protein phosphatase regulator activity. Involved in several processes, including mitochondrion organization; positive regulation of neuron apoptotic process; and protein targeting to mitochondrion. Located in mitochondrial outer membrane. Part of protein phosphatase type 2A complex. Human ortholog(s) of this gene implicated in Alzheimer's disease; brain disease; breast cancer; and spinocerebellar ataxia type 12. Orthologous to human PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta); PARTICIPATES IN platelet-derived growth factor signaling pathway; Chagas disease pathway; hepatitis C pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4',5,5'-hexachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
BRbeta B-regulatory subunit of protein phosphatase 2A; PP2A subunit B isoform B55-beta; PP2A subunit B isoform beta; PP2A subunit B isoform BRB; PP2A subunit B isoform PR55-beta; PP2A subunit B isoform R2-beta; PP2A, subunit B, B-beta isoform; PP2A, subunit B, B55-beta isoform; PP2A, subunit B, BRB isoform; PP2A, subunit B, PR55-beta isoform; PP2A, subunit B, R2-beta isoform; Pppr2b2; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform; protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform; serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ppp2r2b (protein phosphatase 2, regulatory subunit B, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp2r2b (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp2r2b (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp2r2b (protein phosphatase 2 regulatory subunit Bbeta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MTMR9 (myotubularin related protein 9) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ppp2r2b (protein phosphatase 2, regulatory subunit B, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp2r2bb (protein phosphatase 2, regulatory subunit B, beta b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CDC55
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sur-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
tws
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppp2r2b
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Ppp2r2bTn(sb-T2/Bart3)2.239Mcwi
Genetic Models:
F344-Ppp2r2bTn(sb-T2/Bart3)2.239Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 34,904,686 - 35,357,299 (-) NCBI GRCr8 mRatBN7.2 18 34,653,716 - 35,080,889 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 34,653,721 - 35,081,025 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 34,757,854 - 35,184,717 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 35,476,177 - 35,903,042 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 34,853,095 - 35,279,989 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 36,985,709 - 37,421,383 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 36,985,714 - 37,245,809 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 36,647,298 - 37,076,455 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 35,865,837 - 36,318,308 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 35,901,503 - 36,179,323 (-) NCBI Celera 18 34,248,471 - 34,670,726 (-) NCBI Celera Cytogenetic Map 18 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp2r2b Rat 1,1-dichloroethene decreases expression ISO Ppp2r2b (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PPP2R2B mRNA CTD PMID:26682919 Ppp2r2b Rat 1,2-dimethylhydrazine decreases expression ISO Ppp2r2b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PPP2R2B mRNA CTD PMID:22206623 Ppp2r2b Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PPP2R2B mRNA CTD PMID:15834898 and PMID:17557909 Ppp2r2b Rat 17beta-estradiol increases expression ISO Ppp2r2b (Mus musculus) 6480464 Estradiol results in increased expression of PPP2R2B mRNA CTD PMID:19484750 Ppp2r2b Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PPP2R2B mRNA CTD PMID:35192832 Ppp2r2b Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PPP2R2B mRNA CTD PMID:32145629 Ppp2r2b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Ppp2r2b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppp2r2b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppp2r2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP2R2B mRNA CTD PMID:19933214 Ppp2r2b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PPP2R2B mRNA CTD PMID:22298810 Ppp2r2b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ppp2r2b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP2R2B mRNA CTD PMID:16922920 Ppp2r2b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PPP2R2B mRNA CTD PMID:21346803 Ppp2r2b Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of PPP2R2B mRNA CTD PMID:16460773 Ppp2r2b Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Ppp2r2b Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Ppp2r2b Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPP2R2B mRNA CTD PMID:36041667 Ppp2r2b Rat 5-aza-2'-deoxycytidine affects expression ISO PPP2R2B (Homo sapiens) 6480464 Decitabine affects the expression of PPP2R2B mRNA CTD PMID:23300844 Ppp2r2b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PPP2R2B mRNA CTD PMID:24780913 Ppp2r2b Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Ppp2r2b Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of PPP2R2B protein CTD PMID:33236894 Ppp2r2b Rat aflatoxin B1 decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PPP2R2B mRNA CTD PMID:22100608 Ppp2r2b Rat aflatoxin B1 affects methylation ISO PPP2R2B (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of PPP2R2B intron CTD PMID:30157460 Ppp2r2b Rat aflatoxin B1 decreases methylation ISO PPP2R2B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PPP2R2B gene CTD PMID:27153756 Ppp2r2b Rat Aflatoxin B2 alpha increases methylation ISO PPP2R2B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PPP2R2B intron CTD PMID:30157460 Ppp2r2b Rat aflatoxin M1 decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of PPP2R2B mRNA CTD PMID:30928695 Ppp2r2b Rat all-trans-retinoic acid increases expression ISO PPP2R2B (Homo sapiens) 6480464 Tretinoin results in increased expression of PPP2R2B mRNA CTD PMID:16249480 and PMID:23724009 Ppp2r2b Rat alpha-hexachlorocyclohexane decreases expression EXP 6480464 alpha-hexachlorocyclohexane results in decreased expression of PPP2R2B mRNA CTD PMID:17785943 Ppp2r2b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPP2R2B mRNA CTD PMID:16483693 Ppp2r2b Rat arsane multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA more ... CTD PMID:32525701 and PMID:39836092 Ppp2r2b Rat arsenic atom multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA more ... CTD PMID:32525701 and PMID:39836092 Ppp2r2b Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PPP2R2B gene CTD PMID:28931070 and PMID:35440735 Ppp2r2b Rat benzo[a]pyrene decreases methylation ISO Ppp2r2b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of PPP2R2B intron CTD PMID:27901495 Ppp2r2b Rat benzo[a]pyrene decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PPP2R2B mRNA CTD PMID:32234424 Ppp2r2b Rat benzo[a]pyrene affects methylation ISO PPP2R2B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PPP2R2B 5' UTR more ... CTD PMID:27901495 and PMID:30157460 Ppp2r2b Rat benzo[a]pyrene diol epoxide I decreases expression ISO PPP2R2B (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ppp2r2b Rat benzo[e]pyrene increases methylation ISO PPP2R2B (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PPP2R2B intron CTD PMID:30157460 Ppp2r2b Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPP2R2B mRNA CTD PMID:25181051 and PMID:32145629 Ppp2r2b Rat bisphenol A increases expression ISO Ppp2r2b (Mus musculus) 6480464 bisphenol A results in increased expression of PPP2R2B mRNA CTD PMID:32156529 Ppp2r2b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPP2R2B mRNA CTD PMID:36041667 Ppp2r2b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPP2R2B mRNA CTD PMID:35192832 Ppp2r2b Rat bisphenol A increases methylation ISO PPP2R2B (Homo sapiens) 6480464 bisphenol A results in increased methylation of PPP2R2B gene CTD PMID:31601247 Ppp2r2b Rat bisphenol A multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of PPP2R2B gene CTD PMID:31601247 Ppp2r2b Rat bisphenol A decreases expression ISO Ppp2r2b (Mus musculus) 6480464 bisphenol A results in decreased expression of PPP2R2B mRNA CTD PMID:30951980 Ppp2r2b Rat bisphenol F decreases expression ISO Ppp2r2b (Mus musculus) 6480464 bisphenol F results in decreased expression of PPP2R2B mRNA CTD PMID:30951980 Ppp2r2b Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPP2R2B mRNA CTD PMID:36041667 Ppp2r2b Rat bleomycin A5 increases expression ISO PPP2R2B (Homo sapiens) 6480464 bleomycetin results in increased expression of PPP2R2B mRNA CTD PMID:21040473 Ppp2r2b Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of PPP2R2B mRNA CTD PMID:16460773 Ppp2r2b Rat butanal increases expression ISO PPP2R2B (Homo sapiens) 6480464 butyraldehyde results in increased expression of PPP2R2B mRNA CTD PMID:26079696 Ppp2r2b Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat caffeine decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Caffeine results in decreased expression of PPP2R2B mRNA CTD PMID:18444173 Ppp2r2b Rat carbon nanotube decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ppp2r2b Rat CGP 52608 multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PPP2R2B gene] CTD PMID:28238834 Ppp2r2b Rat chromium(6+) multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PPP2R2B mRNA CTD PMID:38479592 Ppp2r2b Rat cisplatin affects expression ISO PPP2R2B (Homo sapiens) 6480464 Cisplatin affects the expression of PPP2R2B mRNA CTD PMID:23300844 Ppp2r2b Rat cisplatin increases expression ISO PPP2R2B (Homo sapiens) 6480464 Cisplatin results in increased expression of PPP2R2B mRNA CTD PMID:27392435 Ppp2r2b Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PPP2R2B mRNA CTD PMID:20187946 Ppp2r2b Rat copper atom multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PPP2R2B mRNA and [Disulfiram binds to Copper] which results in decreased expression of PPP2R2B mRNA CTD PMID:24690739 and PMID:30911355 Ppp2r2b Rat copper atom increases expression EXP 6480464 Copper results in increased expression of PPP2R2B mRNA CTD PMID:30556269 Ppp2r2b Rat copper(0) multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PPP2R2B mRNA and [Disulfiram binds to Copper] which results in decreased expression of PPP2R2B mRNA CTD PMID:24690739 and PMID:30911355 Ppp2r2b Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of PPP2R2B mRNA CTD PMID:30556269 Ppp2r2b Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of PPP2R2B mRNA CTD PMID:15755911 Ppp2r2b Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of PPP2R2B gene CTD PMID:30207508 and PMID:31682807 Ppp2r2b Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of PPP2R2B mRNA CTD PMID:32207525 Ppp2r2b Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of PPP2R2B mRNA CTD PMID:17005392 Ppp2r2b Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PPP2R2B mRNA CTD PMID:37077353 Ppp2r2b Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PPP2R2B mRNA CTD PMID:31199487 Ppp2r2b Rat disulfiram multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPP2R2B mRNA CTD PMID:24690739 Ppp2r2b Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PPP2R2B mRNA CTD PMID:21551480 Ppp2r2b Rat dorsomorphin multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppp2r2b Rat doxorubicin decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PPP2R2B mRNA CTD PMID:29803840 Ppp2r2b Rat ethanol multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PPP2R2B mRNA CTD PMID:30319688 Ppp2r2b Rat folic acid decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Folic Acid results in decreased expression of PPP2R2B mRNA CTD PMID:25629700 Ppp2r2b Rat fulvestrant multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of PPP2R2B gene CTD PMID:31601247 Ppp2r2b Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of PPP2R2B mRNA CTD PMID:17785943 Ppp2r2b Rat genistein increases expression ISO PPP2R2B (Homo sapiens) 6480464 Genistein results in increased expression of PPP2R2B mRNA CTD PMID:18444173 Ppp2r2b Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PPP2R2B mRNA CTD PMID:33387578 Ppp2r2b Rat GW 4064 decreases expression ISO Ppp2r2b (Mus musculus) 6480464 GW 4064 results in decreased expression of PPP2R2B mRNA CTD PMID:26655953 Ppp2r2b Rat inulin multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PPP2R2B mRNA CTD PMID:36331819 Ppp2r2b Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of PPP2R2B mRNA CTD PMID:37077353 Ppp2r2b Rat Lasiocarpine decreases expression ISO PPP2R2B (Homo sapiens) 6480464 lasiocarpine results in decreased expression of PPP2R2B mRNA CTD PMID:32234424 Ppp2r2b Rat lead(0) affects expression ISO PPP2R2B (Homo sapiens) 6480464 Lead affects the expression of PPP2R2B mRNA CTD PMID:28903495 Ppp2r2b Rat LY294002 multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of PPP2R2B mRNA] CTD PMID:12710931 Ppp2r2b Rat manganese atom multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA CTD PMID:39836092 Ppp2r2b Rat manganese(0) multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA CTD PMID:39836092 Ppp2r2b Rat manganese(II) chloride multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA CTD PMID:39836092 Ppp2r2b Rat melphalan decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Melphalan results in decreased expression of PPP2R2B mRNA CTD PMID:22363485 Ppp2r2b Rat mercury dibromide decreases expression ISO PPP2R2B (Homo sapiens) 6480464 mercuric bromide results in decreased expression of PPP2R2B mRNA CTD PMID:26272509 Ppp2r2b Rat mercury dibromide multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP2R2B mRNA CTD PMID:27188386 Ppp2r2b Rat methapyrilene increases methylation ISO PPP2R2B (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PPP2R2B intron CTD PMID:30157460 Ppp2r2b Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PPP2R2B gene CTD PMID:35440735 Ppp2r2b Rat methylmercury chloride decreases expression ISO PPP2R2B (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PPP2R2B mRNA CTD PMID:23179753 more ... Ppp2r2b Rat mono(2-ethylhexyl) phthalate decreases expression ISO PPP2R2B (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PPP2R2B mRNA CTD PMID:36695872 Ppp2r2b Rat N-methyl-4-phenylpyridinium multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of PPP2R2B mRNA] CTD PMID:12710931 Ppp2r2b Rat nevirapine decreases expression EXP 6480464 Nevirapine metabolite results in decreased expression of PPP2R2B mRNA and Nevirapine results in decreased expression of PPP2R2B mRNA CTD PMID:23947594 Ppp2r2b Rat niclosamide decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Niclosamide results in decreased expression of PPP2R2B mRNA CTD PMID:22576131 Ppp2r2b Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PPP2R2B gene CTD PMID:30521419 Ppp2r2b Rat O-methyleugenol decreases expression ISO PPP2R2B (Homo sapiens) 6480464 methyleugenol results in decreased expression of PPP2R2B mRNA CTD PMID:32234424 Ppp2r2b Rat p-chloromercuribenzoic acid decreases expression ISO PPP2R2B (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PPP2R2B mRNA CTD PMID:26272509 Ppp2r2b Rat p-chloromercuribenzoic acid multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP2R2B mRNA CTD PMID:27188386 Ppp2r2b Rat panobinostat multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP2R2B mRNA CTD PMID:27188386 Ppp2r2b Rat panobinostat decreases expression ISO PPP2R2B (Homo sapiens) 6480464 panobinostat results in decreased expression of PPP2R2B mRNA CTD PMID:26272509 Ppp2r2b Rat PCB138 multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppp2r2b Rat pentanal increases expression ISO PPP2R2B (Homo sapiens) 6480464 pentanal results in increased expression of PPP2R2B mRNA CTD PMID:26079696 Ppp2r2b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ppp2r2b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PPP2R2B mRNA CTD PMID:36331819 Ppp2r2b Rat phenylmercury acetate decreases expression ISO PPP2R2B (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PPP2R2B mRNA CTD PMID:26272509 Ppp2r2b Rat phenylmercury acetate multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP2R2B mRNA CTD PMID:27188386 Ppp2r2b Rat pioglitazone increases expression ISO PPP2R2B (Homo sapiens) 6480464 Pioglitazone results in increased expression of PPP2R2B mRNA CTD PMID:32589349 Ppp2r2b Rat potassium chromate increases expression ISO PPP2R2B (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PPP2R2B mRNA CTD PMID:22714537 Ppp2r2b Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PPP2R2B mRNA CTD PMID:19162173 Ppp2r2b Rat progesterone affects expression ISO Ppp2r2b (Mus musculus) 6480464 Progesterone affects the expression of PPP2R2B mRNA CTD PMID:17251523 Ppp2r2b Rat progesterone decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Progesterone results in decreased expression of PPP2R2B mRNA CTD PMID:17556502 and PMID:22238285 Ppp2r2b Rat rotenone affects localization EXP 6480464 Rotenone affects the localization of PPP2R2B protein CTD PMID:18940801 Ppp2r2b Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PPP2R2B mRNA CTD PMID:28374803 Ppp2r2b Rat rotenone decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Rotenone results in decreased expression of PPP2R2B mRNA CTD PMID:23186747 Ppp2r2b Rat SB 431542 multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppp2r2b Rat sodium arsenate multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PPP2R2B mRNA CTD PMID:32525701 Ppp2r2b Rat sodium arsenite multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP2R2B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PPP2R2B mRNA CTD PMID:39836092 Ppp2r2b Rat sodium fluoride decreases expression ISO Ppp2r2b (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PPP2R2B mRNA CTD PMID:21340527 Ppp2r2b Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of PPP2R2B mRNA CTD PMID:27257137 Ppp2r2b Rat staurosporine affects localization EXP 6480464 Staurosporine affects the localization of PPP2R2B protein CTD PMID:18940801 Ppp2r2b Rat sulforaphane decreases expression ISO PPP2R2B (Homo sapiens) 6480464 sulforaphane results in decreased expression of PPP2R2B mRNA CTD PMID:31838189 Ppp2r2b Rat temozolomide increases expression ISO PPP2R2B (Homo sapiens) 6480464 Temozolomide results in increased expression of PPP2R2B mRNA CTD PMID:31758290 Ppp2r2b Rat triadimefon increases expression ISO PPP2R2B (Homo sapiens) 6480464 triadimefon results in increased expression of PPP2R2B mRNA CTD PMID:26705709 Ppp2r2b Rat trichostatin A decreases expression ISO PPP2R2B (Homo sapiens) 6480464 trichostatin A results in decreased expression of PPP2R2B mRNA CTD PMID:26272509 Ppp2r2b Rat trichostatin A multiple interactions ISO PPP2R2B (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP2R2B mRNA CTD PMID:27188386 Ppp2r2b Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of PPP2R2B mRNA CTD PMID:30589522 Ppp2r2b Rat triphenyl phosphate affects expression ISO PPP2R2B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PPP2R2B mRNA CTD PMID:37042841 Ppp2r2b Rat tunicamycin affects localization EXP 6480464 Tunicamycin affects the localization of PPP2R2B protein CTD PMID:18940801 Ppp2r2b Rat valproic acid increases expression ISO PPP2R2B (Homo sapiens) 6480464 Valproic Acid results in increased expression of PPP2R2B mRNA CTD PMID:23179753 more ... Ppp2r2b Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PPP2R2B gene CTD PMID:31079544 Ppp2r2b Rat zoledronic acid affects expression ISO PPP2R2B (Homo sapiens) 6480464 zoledronic acid affects the expression of PPP2R2B mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-nitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) aconitine (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bleomycin A5 (ISO) bromochloroacetic acid (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (ISO) cocaine (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) corticosterone (EXP) DDT (EXP) decabromodiphenyl ether (EXP) dibutyl phthalate (EXP) diethyl phthalate (EXP) diethylstilbestrol (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) fulvestrant (ISO) gamma-hexachlorocyclohexane (EXP) genistein (ISO) gentamycin (EXP) GW 4064 (ISO) inulin (ISO) ketoconazole (EXP) Lasiocarpine (ISO) lead(0) (ISO) LY294002 (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melphalan (ISO) mercury dibromide (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) nevirapine (EXP) niclosamide (ISO) Nor-9-carboxy-delta9-THC (ISO) O-methyleugenol (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) PCB138 (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (EXP,ISO) staurosporine (EXP) sulforaphane (ISO) temozolomide (ISO) triadimefon (ISO) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) tunicamycin (EXP) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
1.
cDNA cloning of BR gamma, a novel brain-specific isoform of the B regulatory subunit of type-2A protein phosphatase.
Akiyama N, etal., Eur J Biochem 1995 Jun 1;230(2):766-72.
2.
Spinocerebellar ataxia type 12 identified in two Italian families may mimic sporadic ataxia.
Brussino A, etal., Mov Disord. 2010 Jul 15;25(9):1269-73.
3.
Induction of PP2A Bbeta, a regulator of IL-2 deprivation-induced T-cell apoptosis, is deficient in systemic lupus erythematosus.
Crispin JC, etal., Proc Natl Acad Sci U S A. 2011 Jul 26;108(30):12443-8. Epub 2011 Jul 11.
4.
A developmentally regulated, neuron-specific splice variant of the variable subunit Bbeta targets protein phosphatase 2A to mitochondria and modulates apoptosis.
Dagda RK, etal., J Biol Chem. 2003 Jul 4;278(27):24976-85. Epub 2003 Apr 24.
5.
Unfolding-resistant translocase targeting: a novel mechanism for outer mitochondrial membrane localization exemplified by the Bbeta2 regulatory subunit of protein phosphatase 2A.
Dagda RK, etal., J Biol Chem. 2005 Jul 22;280(29):27375-82. Epub 2005 May 27.
6.
The spinocerebellar ataxia 12 gene product and protein phosphatase 2A regulatory subunit Bbeta2 antagonizes neuronal survival by promoting mitochondrial fission.
Dagda RK, etal., J Biol Chem. 2008 Dec 26;283(52):36241-8. Epub 2008 Oct 21.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Expression of PP2A B regulatory subunit beta isotype in rat testis.
Hatano Y, etal., FEBS Lett 1993 Jun 7;324(1):71-5.
10.
Association between CAG repeat length in the PPP2R2B gene and Alzheimer disease in the Japanese population.
Kimura R, etal., Neurosci Lett. 2011 Jan 10;487(3):354-7. Epub 2010 Oct 26.
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Brain protein phosphatase 2A: developmental regulation and distinct cellular and subcellular localization by B subunits.
Strack S, etal., J Comp Neurol. 1998 Mar 23;392(4):515-27.
18.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
19.
A genetic variant in a PP2A regulatory subunit encoded by the PPP2R2B gene associates with altered breast cancer risk and recurrence.
Vazquez A, etal., Int J Cancer. 2011 May 15;128(10):2335-43. doi: 10.1002/ijc.25582.
20.
Mitochondrial dysfunction and oxidative stress contribute to the pathogenesis of spinocerebellar ataxia type 12 (SCA12).
Wang YC, etal., J Biol Chem. 2011 Jun 17;286(24):21742-54. Epub 2011 Apr 6.
Ppp2r2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 34,904,686 - 35,357,299 (-) NCBI GRCr8 mRatBN7.2 18 34,653,716 - 35,080,889 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 34,653,721 - 35,081,025 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 34,757,854 - 35,184,717 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 35,476,177 - 35,903,042 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 34,853,095 - 35,279,989 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 36,985,709 - 37,421,383 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 36,985,714 - 37,245,809 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 36,647,298 - 37,076,455 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 35,865,837 - 36,318,308 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 35,901,503 - 36,179,323 (-) NCBI Celera 18 34,248,471 - 34,670,726 (-) NCBI Celera Cytogenetic Map 18 p11 NCBI
PPP2R2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 146,580,742 - 147,081,520 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 146,580,742 - 147,084,784 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 145,960,305 - 146,461,083 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 145,949,260 - 146,441,207 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 145,949,261 - 146,441,207 NCBI Celera 5 142,050,506 - 142,543,249 (-) NCBI Celera Cytogenetic Map 5 q32 NCBI HuRef 5 141,115,900 - 141,608,335 (-) NCBI HuRef CHM1_1 5 145,401,722 - 145,893,553 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 147,116,637 - 147,617,597 (-) NCBI T2T-CHM13v2.0
Ppp2r2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 42,777,811 - 43,192,827 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 42,770,497 - 43,216,192 (-) Ensembl GRCm39 Ensembl GRCm38 18 42,645,207 - 43,059,471 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 42,637,432 - 43,059,471 (-) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 42,637,432 - 43,083,127 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 42,804,923 - 43,219,125 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 42,771,242 - 43,184,802 (-) NCBI MGSCv36 mm8 Celera 18 44,014,172 - 44,430,759 (-) NCBI Celera Cytogenetic Map 18 B3 NCBI cM Map 18 22.75 NCBI
Ppp2r2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 7,090,671 - 7,511,995 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 7,054,296 - 7,510,179 (+) NCBI ChiLan1.0 ChiLan1.0
PPP2R2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 141,841,949 - 142,325,863 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 139,981,500 - 140,465,413 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 142,037,831 - 142,521,655 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 148,050,581 - 148,533,583 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 148,050,581 - 148,533,329 (-) Ensembl panpan1.1 panPan2
PPP2R2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 41,005,259 - 41,447,048 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 41,005,644 - 41,459,878 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 38,048,790 - 38,488,981 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 41,461,404 - 41,901,150 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 41,461,411 - 41,901,167 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 38,535,055 - 38,978,764 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 39,344,752 - 39,785,267 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 40,170,245 - 40,610,151 (-) NCBI UU_Cfam_GSD_1.0
Ppp2r2b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 146,081,945 - 146,522,525 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936504 7,656,298 - 8,097,276 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936504 7,655,924 - 8,097,125 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP2R2B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 147,937,442 - 148,411,731 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 147,938,074 - 148,422,825 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 154,429,929 - 154,517,148 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP2R2B
Ppp2r2b
.
Predicted Target Of
Count of predictions: 479 Count of miRNA genes: 253 Interacting mature miRNAs: 299 Transcripts: ENSRNOT00000041188 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2301413 Bp318 Blood pressure QTL 318 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 26548082 46969551 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61388 Bp2 Blood pressure QTL 2 3.23 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 1 35374722 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 12904668 Bw188 Body weight QTL 188 0.03 body mass (VT:0001259) body weight (CMO:0000012) 18 26548082 46969551 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 12904669 Cm125 Cardiac mass QTL 125 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 26548082 46969551 Rat 1641923 Colcr8 Colorectal carcinoma resistance QTL 8 3.1 0.0014 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 18 22066242 52293055 Rat 12904670 Cm126 Cardiac mass QTL 126 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 26548082 46969551 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 2312568 Glom21 Glomerulus QTL 21 2 0.005 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 18 5185858 40503530 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 12904677 Kidm72 Kidney mass QTL 72 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 26548082 46969551 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 12904673 Cm127 Cardiac mass QTL 127 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 26548082 46969551 Rat 12904675 Am19 Aortic mass QTL 19 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 26548082 46969551 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331753 Bp231 Blood pressure QTL 231 3.643 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944299 52293055 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 61375 Bp41 Blood pressure QTL 41 2.4 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 18 11944299 41122201 Rat
D18Rat139
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 34,961,181 - 34,961,413 (+) Marker Load Pipeline mRatBN7.2 18 34,710,216 - 34,710,448 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,042,221 - 37,042,452 NCBI Rnor6.0 Rnor_5.0 18 36,703,395 - 36,703,626 UniSTS Rnor5.0 RGSC_v3.4 18 35,922,193 - 35,922,425 RGD RGSC3.4 RGSC_v3.4 18 35,922,194 - 35,922,425 UniSTS RGSC3.4 RGSC_v3.1 18 35,957,459 - 35,957,691 RGD Celera 18 34,304,851 - 34,305,082 UniSTS SHRSP x BN Map 18 17.1699 UniSTS SHRSP x BN Map 18 17.1699 RGD Cytogenetic Map 18 p11 UniSTS
D18Got80
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 34,891,756 - 34,891,899 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,224,298 - 37,224,440 NCBI Rnor6.0 Rnor_5.0 18 36,884,885 - 36,885,027 UniSTS Rnor5.0 RGSC_v3.4 18 36,122,754 - 36,122,897 RGD RGSC3.4 RGSC_v3.4 18 36,122,755 - 36,122,897 UniSTS RGSC3.4 RGSC_v3.1 18 36,158,020 - 36,158,163 RGD Celera 18 34,482,873 - 34,483,015 UniSTS Cytogenetic Map 18 p11 UniSTS
D18Chm46
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 35,035,986 - 35,036,216 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,375,987 - 37,376,216 NCBI Rnor6.0 Rnor_5.0 18 37,031,940 - 37,032,169 UniSTS Rnor5.0 RGSC_v3.4 18 36,268,700 - 36,268,929 UniSTS RGSC3.4 Cytogenetic Map 18 p11 UniSTS
D18Got126
Rat Assembly Chr Position (strand) Source JBrowse Celera 18 34,523,700 - 34,523,883 UniSTS Cytogenetic Map 18 p11 UniSTS
RH127928
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 34,653,895 - 34,654,084 (+) MAPPER mRatBN7.2 Rnor_6.0 18 36,985,889 - 36,986,077 NCBI Rnor6.0 Rnor_5.0 18 36,647,478 - 36,647,666 UniSTS Rnor5.0 RGSC_v3.4 18 35,865,968 - 35,866,156 UniSTS RGSC3.4 Celera 18 34,248,651 - 34,248,839 UniSTS Cytogenetic Map 18 p11 UniSTS
AU047127
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 34,669,428 - 34,669,580 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,001,422 - 37,001,573 NCBI Rnor6.0 Rnor_5.0 18 36,663,011 - 36,663,162 UniSTS Rnor5.0 RGSC_v3.4 18 35,881,501 - 35,881,652 UniSTS RGSC3.4 Celera 18 34,264,184 - 34,264,335 UniSTS Cytogenetic Map 18 p11 UniSTS
AU048553
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 34,805,553 - 34,805,821 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,137,923 - 37,138,190 NCBI Rnor6.0 Rnor_5.0 18 36,798,929 - 36,799,196 UniSTS Rnor5.0 RGSC_v3.4 18 36,018,045 - 36,018,312 UniSTS RGSC3.4 Celera 18 34,396,765 - 34,397,032 UniSTS Cytogenetic Map 18 p11 UniSTS
AU048718
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 34,977,075 - 34,977,264 (+) MAPPER mRatBN7.2 Rnor_6.0 18 37,315,939 - 37,316,127 NCBI Rnor6.0 Rnor_5.0 18 36,973,415 - 36,973,603 UniSTS Rnor5.0 RGSC_v3.4 18 36,209,474 - 36,209,662 UniSTS RGSC3.4 Celera 18 34,567,235 - 34,567,423 UniSTS Cytogenetic Map 18 p11 UniSTS
This gene Ppp2r2b is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041188 ⟹ ENSRNOP00000041264
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 34,764,165 (-) Ensembl Rnor_6.0 Ensembl 18 36,985,714 - 37,096,132 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079585 ⟹ ENSRNOP00000071824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,654,105 - 34,952,055 (-) Ensembl Rnor_6.0 Ensembl 18 36,986,162 - 37,245,809 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091634 ⟹ ENSRNOP00000071716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 34,952,119 (-) Ensembl Rnor_6.0 Ensembl 18 36,986,095 - 37,132,223 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097489 ⟹ ENSRNOP00000096088
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 34,952,119 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107651 ⟹ ENSRNOP00000077436
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 35,081,025 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112290 ⟹ ENSRNOP00000081049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 34,952,119 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118131 ⟹ ENSRNOP00000093860
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 34,653,721 - 34,952,119 (-) Ensembl
RefSeq Acc Id:
NM_001402382 ⟹ NP_001389311
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,686 - 35,165,016 (-) NCBI mRatBN7.2 18 34,653,716 - 34,914,051 (-) NCBI
RefSeq Acc Id:
NM_022209 ⟹ NP_071545
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,686 - 35,331,615 (-) NCBI mRatBN7.2 18 34,653,716 - 35,080,666 (-) NCBI Rnor_6.0 18 36,985,709 - 37,421,383 (-) NCBI Rnor_5.0 18 36,647,298 - 37,076,455 (-) NCBI RGSC_v3.4 18 35,865,837 - 36,318,308 (-) RGD Celera 18 34,248,471 - 34,670,726 (-) NCBI
Sequence:
TGTAAGGCATTGCTTCCTAGCGCTGATGGCAAAATGGGACCCATCTCCAGTTATTCCTTGGGCTTCCCAGCTCTGCAGATCTGGGAGAGAACCTACATAAACATATTGGTGATGTAGCCAGCTTTCAA
hide sequence
RefSeq Acc Id:
NR_073588
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,686 - 35,203,014 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,055 (-) NCBI Rnor_6.0 18 36,985,709 - 37,291,494 (-) NCBI Rnor_5.0 18 36,647,298 - 37,076,455 (-) NCBI Celera 18 34,248,471 - 34,542,212 (-) NCBI
Sequence:
CCAAGAACACTGGGCTGCCTCTTAAGACCTAGTTGGCAGTCCAATATGTGAGTAACTCCAGAACAGCAGGGGGGGAGAAAAGGTCAATTGGGAATATCTGATAGATACTGAAAGCCCTGGAGAGATGT
hide sequence
RefSeq Acc Id:
XM_017601026 ⟹ XP_017456515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,074,380 (-) NCBI mRatBN7.2 18 34,653,716 - 34,823,414 (-) NCBI Rnor_6.0 18 36,985,712 - 37,155,807 (-) NCBI
Sequence:
CCCAGGTTAGCATGAATCTTAAGATCGTCCTGTTTGTGCCCAGCAGGTGTTAACGTTCCAGGTT
hide sequence
RefSeq Acc Id:
XM_017601028 ⟹ XP_017456517
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,059 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,102 (-) NCBI Rnor_6.0 18 36,985,712 - 37,291,538 (-) NCBI
Sequence:
TCAGACTGTGGAGACCCAGGATGAGAGAGAGTTGGGAGGGAGTACCAAGAACACTGGGCTGCCTCTTAAGACCTAGTTGGCAGTCCAATATGTGAGTAACTCCAGAACAGCAGGGGGGGAGAAAAGGT
hide sequence
RefSeq Acc Id:
XM_039097058 ⟹ XP_038952986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,331,842 (-) NCBI mRatBN7.2 18 34,653,716 - 35,080,889 (-) NCBI
RefSeq Acc Id:
XM_039097059 ⟹ XP_038952987
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,165,029 (-) NCBI mRatBN7.2 18 34,653,716 - 34,914,070 (-) NCBI
RefSeq Acc Id:
XM_039097060 ⟹ XP_038952988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,104 (-) NCBI
RefSeq Acc Id:
XM_039097062 ⟹ XP_038952990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,050,757 (-) NCBI mRatBN7.2 18 34,653,716 - 34,799,791 (-) NCBI
RefSeq Acc Id:
XM_039097063 ⟹ XP_038952991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,107,885 (-) NCBI mRatBN7.2 18 34,653,716 - 34,857,103 (-) NCBI
RefSeq Acc Id:
XM_039097064 ⟹ XP_038952992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,074,404 (-) NCBI mRatBN7.2 18 34,653,716 - 34,823,421 (-) NCBI
RefSeq Acc Id:
XM_039097065 ⟹ XP_038952993
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,104 (-) NCBI
RefSeq Acc Id:
XM_039097066 ⟹ XP_038952994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,104 (-) NCBI
RefSeq Acc Id:
XM_039097068 ⟹ XP_038952996
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,104 (-) NCBI
RefSeq Acc Id:
XM_039097069 ⟹ XP_038952997
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,193,294 (-) NCBI mRatBN7.2 18 34,653,716 - 34,833,872 (-) NCBI
RefSeq Acc Id:
XM_039097071 ⟹ XP_038952999
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,107,885 (-) NCBI mRatBN7.2 18 34,653,716 - 34,857,099 (-) NCBI
RefSeq Acc Id:
XM_039097072 ⟹ XP_038953000
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,052 (-) NCBI mRatBN7.2 18 34,653,716 - 34,952,098 (-) NCBI
RefSeq Acc Id:
XM_063277526 ⟹ XP_063133596
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 35,213,359 - 35,356,923 (-) NCBI
RefSeq Acc Id:
XM_063277527 ⟹ XP_063133597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,165,029 (-) NCBI
RefSeq Acc Id:
XM_063277528 ⟹ XP_063133598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI
RefSeq Acc Id:
XM_063277529 ⟹ XP_063133599
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,050,757 (-) NCBI
RefSeq Acc Id:
XM_063277531 ⟹ XP_063133601
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,055 (-) NCBI
RefSeq Acc Id:
XM_063277532 ⟹ XP_063133602
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,059 (-) NCBI
RefSeq Acc Id:
XM_063277533 ⟹ XP_063133603
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,203,058 (-) NCBI
RefSeq Acc Id:
XM_063277534 ⟹ XP_063133604
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,084,830 (-) NCBI
RefSeq Acc Id:
XM_063277535 ⟹ XP_063133605
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 34,904,689 - 35,357,299 (-) NCBI
RefSeq Acc Id:
NP_071545 ⟸ NM_022209
- Peptide Label:
isoform 1
- UniProtKB:
A6J3L0 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
- Sequence:
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDK
hide sequence
RefSeq Acc Id:
XP_017456517 ⟸ XM_017601028
- Peptide Label:
isoform X12
- UniProtKB:
A0A0G2K165 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
- Sequence:
MKLFSADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDY
hide sequence
RefSeq Acc Id:
XP_017456515 ⟸ XM_017601026
- Peptide Label:
isoform X11
- UniProtKB:
A0A8I5ZU97 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
- Sequence:
MTSHQRADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATI
hide sequence
Ensembl Acc Id:
ENSRNOP00000041264 ⟸ ENSRNOT00000041188
Ensembl Acc Id:
ENSRNOP00000071824 ⟸ ENSRNOT00000079585
Ensembl Acc Id:
ENSRNOP00000071716 ⟸ ENSRNOT00000091634
RefSeq Acc Id:
XP_038952986 ⟸ XM_039097058
- Peptide Label:
isoform X2
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952996 ⟸ XM_039097068
- Peptide Label:
isoform X7
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952993 ⟸ XM_039097065
- Peptide Label:
isoform X7
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952988 ⟸ XM_039097060
- Peptide Label:
isoform X3
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952994 ⟸ XM_039097066
- Peptide Label:
isoform X7
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953000 ⟸ XM_039097072
- Peptide Label:
isoform X14
- UniProtKB:
A6K6P2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952987 ⟸ XM_039097059
- Peptide Label:
isoform X3
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952991 ⟸ XM_039097063
- Peptide Label:
isoform X5
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952999 ⟸ XM_039097071
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I6ANA4 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952997 ⟸ XM_039097069
- Peptide Label:
isoform X8
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952992 ⟸ XM_039097064
- Peptide Label:
isoform X6
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952990 ⟸ XM_039097062
- Peptide Label:
isoform X4
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000077436 ⟸ ENSRNOT00000107651
Ensembl Acc Id:
ENSRNOP00000081049 ⟸ ENSRNOT00000112290
Ensembl Acc Id:
ENSRNOP00000096088 ⟸ ENSRNOT00000097489
Ensembl Acc Id:
ENSRNOP00000093860 ⟸ ENSRNOT00000118131
RefSeq Acc Id:
NP_001389311 ⟸ NM_001402382
- Peptide Label:
isoform 2
- UniProtKB:
P36877 (UniProtKB/Swiss-Prot), Q80W84 (UniProtKB/Swiss-Prot), A6J3L2 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133605 ⟸ XM_063277535
- Peptide Label:
isoform X14
- UniProtKB:
A6K6P2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133602 ⟸ XM_063277532
- Peptide Label:
isoform X12
- UniProtKB:
A0A0G2K165 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133603 ⟸ XM_063277533
- Peptide Label:
isoform X12
- UniProtKB:
A0A0G2K165 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133598 ⟸ XM_063277528
- Peptide Label:
isoform X3
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133601 ⟸ XM_063277531
- Peptide Label:
isoform X12
- UniProtKB:
A0A0G2K165 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133597 ⟸ XM_063277527
- Peptide Label:
isoform X3
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133604 ⟸ XM_063277534
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I6AXN0 (UniProtKB/TrEMBL), Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133599 ⟸ XM_063277529
- Peptide Label:
isoform X9
- UniProtKB:
Z4YNW7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133596 ⟸ XM_063277526
- Peptide Label:
isoform X1
- UniProtKB:
A6K9H8 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-7693 BioCyc
Ensembl Genes ENSRNOG00000018851 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000041188 ENTREZGENE
ENSRNOT00000079585 ENTREZGENE
ENSRNOT00000079585.2 UniProtKB/Swiss-Prot
ENSRNOT00000091634 ENTREZGENE
ENSRNOT00000097489 ENTREZGENE
ENSRNOT00000107651.1 UniProtKB/Swiss-Prot
ENSRNOT00000112290 ENTREZGENE
ENSRNOT00000118131 ENTREZGENE
ENSRNOT00000131113 ENTREZGENE
ENSRNOT00000157140 ENTREZGENE
Gene3D-CATH 2.130.10.10 UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:7114294 IMAGE-MGC_LOAD
InterPro PP2A_PR55 UniProtKB/Swiss-Prot
PP2A_PR55_CS UniProtKB/Swiss-Prot
WD40/YVTN_repeat-like_dom_sf UniProtKB/Swiss-Prot
WD40_repeat UniProtKB/Swiss-Prot
WD40_repeat_dom_sf UniProtKB/Swiss-Prot
KEGG Report rno:60660 UniProtKB/Swiss-Prot
MGC_CLONE MGC:93454 IMAGE-MGC_LOAD
NCBI Gene 60660 ENTREZGENE
PANTHER PTHR11871 UniProtKB/Swiss-Prot
PhenoGen Ppp2r2b PhenoGen
PIRSF PP2A_PR55 UniProtKB/Swiss-Prot
PRINTS PP2APR55 UniProtKB/Swiss-Prot
PROSITE PR55_1 UniProtKB/Swiss-Prot
PR55_2 UniProtKB/Swiss-Prot
WD_REPEATS_1 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000018851 RatGTEx
SMART WD40 UniProtKB/Swiss-Prot
Superfamily-SCOP SSF50978 UniProtKB/Swiss-Prot
UniProt 2ABB_RAT UniProtKB/Swiss-Prot
A0A0G2K165 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZU97 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6ANA4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AXN0 ENTREZGENE, UniProtKB/TrEMBL
A6J3K9_RAT UniProtKB/TrEMBL
A6J3L0 ENTREZGENE, UniProtKB/TrEMBL
A6J3L2 ENTREZGENE, UniProtKB/TrEMBL
A6K6P2 ENTREZGENE, UniProtKB/TrEMBL
A6K9H8 ENTREZGENE, UniProtKB/TrEMBL
P36877 ENTREZGENE
Q80W84 ENTREZGENE
Z4YNW7 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary Q80W84 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Ppp2r2b
protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
Pppr2b2
Symbol updated
1299863 APPROVED
Note Type
Note
Reference
gene_expression
expressed in brain and testis
633587
