Symbol:
Rplp1 (Ensembl: LOC100360522)
Name:
ribosomal protein lateral stalk subunit P1 (Ensembl:ribosomal protein P1-like)
RGD ID:
621774
Description:
Enables ribonucleoprotein complex binding activity. Involved in cellular response to Thyroid stimulating hormone; cellular response to cAMP; and positive regulation of translation. Part of cytosolic large ribosomal subunit. Orthologous to human RPLP1 (ribosomal protein lateral stalk subunit P1); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
60S acidic ribosomal protein P1; large ribosomal subunit protein P1; MGC72935; ribosomal protein, large, P1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPLP1 (ribosomal protein lateral stalk subunit P1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Rplp1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rplp1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPLP1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RPLP1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rplp1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPLP1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPLP1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rplp1 (ribosomal protein lateral stalk subunit P1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
RPLP1 (ribosomal protein lateral stalk subunit P1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Rplp1 (ribosomal protein lateral stalk subunit P1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
rplp1 (ribosomal protein, large, P1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rla-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPP1A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
RPP1B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
RpLP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rplp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 71,289,539 - 71,290,872 (-) NCBI GRCr8 mRatBN7.2 8 62,394,008 - 62,395,341 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 62,393,177 - 62,395,339 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 67,908,441 - 67,909,773 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 66,180,953 - 66,182,285 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 64,050,881 - 64,052,213 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 66,862,143 - 66,863,476 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 66,862,143 - 66,863,476 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 66,594,524 - 66,595,857 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 66,046,220 - 66,047,553 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 66,065,272 - 66,066,576 (-) NCBI Celera 8 61,813,792 - 61,815,125 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rplp1 Rat (1->4)-beta-D-glucan multiple interactions ISO Rplp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPLP1 mRNA CTD PMID:36331819 Rplp1 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Rplp1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rplp1 Rat 1,2-dimethylhydrazine multiple interactions ISO Rplp1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPLP1 mRNA CTD PMID:22206623 Rplp1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Rplp1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rplp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rplp1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rplp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RPLP1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Rplp1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Rplp1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rplp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rplp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RPLP1 mRNA CTD PMID:21570461 Rplp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPLP1 mRNA CTD PMID:33387578 Rplp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RPLP1 mRNA CTD PMID:34747641 Rplp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RPLP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of RPLP1 mRNA CTD PMID:21807756 Rplp1 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Rplp1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rplp1 Rat 2,4,6-tribromophenol decreases expression ISO RPLP1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Rplp1 Rat 2,6-dimethoxyphenol multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of RPLP1 protein CTD PMID:38598786 Rplp1 Rat 2-hydroxypropanoic acid increases expression ISO RPLP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RPLP1 mRNA CTD PMID:30851411 Rplp1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of RPLP1 protein CTD PMID:34915118 Rplp1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Rplp1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of RPLP1 mRNA CTD PMID:18648102 Rplp1 Rat 4,4'-sulfonyldiphenol affects expression ISO Rplp1 (Mus musculus) 6480464 bisphenol S affects the expression of RPLP1 mRNA CTD PMID:39298647 Rplp1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of RPLP1 mRNA CTD PMID:36041667 Rplp1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of RPLP1 mRNA CTD PMID:31881176 Rplp1 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of RPLP1 protein CTD PMID:33236894 Rplp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPLP1 mRNA CTD PMID:16483693 Rplp1 Rat aristolochic acid A decreases expression ISO RPLP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RPLP1 protein CTD PMID:33212167 Rplp1 Rat Aroclor 1254 increases expression ISO Rplp1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of RPLP1 mRNA CTD PMID:23650126 Rplp1 Rat arsenite(3-) multiple interactions ISO RPLP1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPLP1 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to RPLP1 protein] CTD PMID:32406909 Rplp1 Rat benzatropine multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of RPLP1 protein CTD PMID:34122009 Rplp1 Rat benzo[a]pyrene decreases expression ISO Rplp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RPLP1 mRNA CTD PMID:20504355 Rplp1 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO RPLP1 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of RPLP1 protein CTD PMID:19845377 Rplp1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rplp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RPLP1 mRNA CTD PMID:33754040 Rplp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RPLP1 mRNA CTD PMID:25181051 Rplp1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of RPLP1 mRNA CTD PMID:36041667 Rplp1 Rat bisphenol A decreases expression ISO Rplp1 (Mus musculus) 6480464 bisphenol A results in decreased expression of RPLP1 mRNA CTD PMID:35598803 Rplp1 Rat bisphenol A decreases expression ISO RPLP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPLP1 mRNA and bisphenol A results in decreased expression of RPLP1 protein CTD PMID:31675489 more ... Rplp1 Rat bisphenol A increases expression ISO RPLP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of RPLP1 protein CTD PMID:33376534 Rplp1 Rat bisphenol A increases expression ISO Rplp1 (Mus musculus) 6480464 bisphenol A results in increased expression of RPLP1 mRNA CTD PMID:38074096 Rplp1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPLP1 mRNA CTD PMID:32145629 Rplp1 Rat bisphenol A affects expression ISO RPLP1 (Homo sapiens) 6480464 bisphenol A affects the expression of RPLP1 mRNA CTD PMID:30903817 Rplp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RPLP1 mRNA CTD PMID:27571134 Rplp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RPLP1 gene CTD PMID:28505145 Rplp1 Rat bisphenol AF increases expression ISO RPLP1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of RPLP1 protein CTD PMID:34186270 Rplp1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of RPLP1 mRNA CTD PMID:36041667 Rplp1 Rat cadmium dichloride increases expression ISO RPLP1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RPLP1 mRNA CTD PMID:38568856 Rplp1 Rat chloropicrin affects expression ISO RPLP1 (Homo sapiens) 6480464 chloropicrin affects the expression of RPLP1 mRNA CTD PMID:26352163 Rplp1 Rat chlorpyrifos increases expression ISO Rplp1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RPLP1 mRNA CTD PMID:37019170 Rplp1 Rat cisplatin decreases expression ISO RPLP1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of RPLP1 mRNA CTD PMID:27594783 Rplp1 Rat crocidolite asbestos increases expression ISO RPLP1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of RPLP1 protein CTD PMID:29553831 Rplp1 Rat CU-O LINKAGE increases expression ISO RPLP1 (Homo sapiens) 6480464 cupric oxide results in increased expression of RPLP1 protein CTD PMID:25470785 Rplp1 Rat Cuprizon multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of RPLP1 protein CTD PMID:34122009 Rplp1 Rat cyhalothrin increases expression EXP 6480464 cyhalothrin results in increased expression of RPLP1 mRNA CTD PMID:29727961 Rplp1 Rat decabromodiphenyl ether decreases expression ISO RPLP1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of RPLP1 protein CTD PMID:31675489 Rplp1 Rat deoxynivalenol increases phosphorylation ISO Rplp1 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of RPLP1 protein CTD PMID:23811945 Rplp1 Rat deoxynivalenol decreases phosphorylation ISO Rplp1 (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of RPLP1 protein CTD PMID:23352502 Rplp1 Rat disulfiram increases expression ISO RPLP1 (Homo sapiens) 6480464 Disulfiram results in increased expression of RPLP1 protein CTD PMID:34182011 Rplp1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of RPLP1 mRNA CTD PMID:21551480 Rplp1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RPLP1 mRNA CTD PMID:29391264 Rplp1 Rat enzyme inhibitor multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPLP1 protein CTD PMID:23301498 Rplp1 Rat ethanol affects expression ISO Rplp1 (Mus musculus) 6480464 Ethanol affects the expression of RPLP1 mRNA CTD PMID:30319688 Rplp1 Rat fenthion increases expression ISO Rplp1 (Mus musculus) 6480464 Fenthion results in increased expression of RPLP1 mRNA CTD PMID:34813904 Rplp1 Rat folic acid multiple interactions ISO Rplp1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPLP1 mRNA CTD PMID:22206623 Rplp1 Rat furfural multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of RPLP1 protein CTD PMID:38598786 Rplp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RPLP1 mRNA CTD PMID:22061828 Rplp1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of RPLP1 mRNA CTD PMID:24136188 Rplp1 Rat hydralazine multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPLP1 mRNA CTD PMID:17183730 Rplp1 Rat hydrogen peroxide affects expression ISO RPLP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RPLP1 mRNA CTD PMID:21179406 Rplp1 Rat inulin multiple interactions ISO Rplp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of RPLP1 mRNA CTD PMID:36331819 Rplp1 Rat ivermectin decreases expression ISO RPLP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPLP1 protein CTD PMID:32959892 Rplp1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of RPLP1 mRNA CTD PMID:28935588 Rplp1 Rat methotrexate affects expression ISO Rplp1 (Mus musculus) 6480464 Methotrexate affects the expression of RPLP1 mRNA CTD PMID:18502557 Rplp1 Rat methylisothiazolinone increases expression ISO RPLP1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of RPLP1 mRNA CTD PMID:31629900 Rplp1 Rat methylparaben decreases expression ISO RPLP1 (Homo sapiens) 6480464 methylparaben results in decreased expression of RPLP1 mRNA CTD PMID:38568856 Rplp1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Rplp1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of RPLP1 protein CTD PMID:26558463 Rplp1 Rat N-methyl-4-phenylpyridinium decreases expression ISO RPLP1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of RPLP1 protein CTD PMID:24806433 Rplp1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of RPLP1 mRNA CTD PMID:24136188 Rplp1 Rat nitric oxide increases expression ISO Rplp1 (Mus musculus) 6480464 Nitric Oxide deficiency results in increased expression of RPLP1 mRNA CTD PMID:15878706 Rplp1 Rat paclitaxel decreases response to substance ISO RPLP1 (Homo sapiens) 6480464 RPLP1 mRNA results in decreased susceptibility to Paclitaxel CTD PMID:16322897 Rplp1 Rat paracetamol affects expression ISO Rplp1 (Mus musculus) 6480464 Acetaminophen affects the expression of RPLP1 mRNA CTD PMID:17562736 Rplp1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of RPLP1 mRNA CTD PMID:32680482 Rplp1 Rat PCB138 multiple interactions ISO Rplp1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rplp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rplp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPLP1 mRNA more ... CTD PMID:36331819 Rplp1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RPLP1 mRNA CTD PMID:15215175 Rplp1 Rat rac-lactic acid increases expression ISO RPLP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RPLP1 mRNA CTD PMID:30851411 Rplp1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Rplp1 (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of RPLP1 mRNA CTD PMID:15878706 Rplp1 Rat SB 431542 multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RPLP1 protein CTD PMID:37664457 Rplp1 Rat senecionine increases expression ISO Rplp1 (Mus musculus) 6480464 senecionine results in increased expression of RPLP1 protein CTD PMID:35357534 Rplp1 Rat sodium chloride multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of RPLP1 protein more ... CTD PMID:38598786 Rplp1 Rat sunitinib increases expression ISO RPLP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of RPLP1 mRNA CTD PMID:31533062 Rplp1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of RPLP1 mRNA CTD PMID:33387578 Rplp1 Rat titanium dioxide decreases methylation ISO Rplp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RPLP1 gene and titanium dioxide results in decreased methylation of RPLP1 promoter CTD PMID:35295148 Rplp1 Rat triphenyl phosphate affects expression ISO RPLP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RPLP1 mRNA CTD PMID:37042841 Rplp1 Rat tungsten increases expression ISO Rplp1 (Mus musculus) 6480464 Tungsten results in increased expression of RPLP1 mRNA CTD PMID:30912803 Rplp1 Rat valproic acid decreases methylation ISO RPLP1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of RPLP1 gene CTD PMID:29154799 Rplp1 Rat valproic acid multiple interactions ISO RPLP1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPLP1 mRNA CTD PMID:17183730 Rplp1 Rat valproic acid affects expression ISO Rplp1 (Mus musculus) 6480464 Valproic Acid affects the expression of RPLP1 mRNA CTD PMID:17963808
(1->4)-beta-D-glucan (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acetamide (EXP) aconitine (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP) cadmium dichloride (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) cyhalothrin (EXP) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) disulfiram (ISO) diuron (EXP) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) furfural (ISO) gentamycin (EXP) glafenine (EXP) hydralazine (ISO) hydrogen peroxide (ISO) inulin (ISO) ivermectin (ISO) methapyrilene (EXP) methotrexate (ISO) methylisothiazolinone (ISO) methylparaben (ISO) N-methyl-4-phenylpyridinium (ISO) nimesulide (EXP) nitric oxide (ISO) paclitaxel (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (EXP) rac-lactic acid (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 431542 (ISO) senecionine (ISO) sodium chloride (ISO) sunitinib (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO)
1.
Structures of the human and Drosophila 80S ribosome.
Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Thyrotropin stimulates the expression of an acidic ribosomal protein, P0, messenger ribonucleic acid in cultured rat thyroid (FRTL) cells.
Ikeda M, etal., Endocrinology. 1991 May;128(5):2540-7.
5.
The primary structure of the acidic phosphoprotein P2 from rat liver 60 S ribosomal subunits. Comparison with ribosomal 'A' proteins from other species.
Lin A, etal., J Biol Chem. 1982 Aug 10;257(15):9189-97.
6.
Landscape of the hnRNP K protein-protein interactome.
Mikula M, etal., Proteomics. 2006 Apr;6(8):2395-406.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
A specific role for the phosphorylation of mammalian acidic ribosomal protein P2.
Vard C, etal., J Biol Chem. 1997 Aug 8;272(32):20259-62.
12.
The primary structure of rat ribosomal proteins P0, P1, and P2 and a proposal for a uniform nomenclature for mammalian and yeast ribosomal proteins.
Wool IG, etal., Biochimie 1991 Jul-Aug;73(7-8):861-70.
Rplp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 71,289,539 - 71,290,872 (-) NCBI GRCr8 mRatBN7.2 8 62,394,008 - 62,395,341 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 62,393,177 - 62,395,339 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 67,908,441 - 67,909,773 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 66,180,953 - 66,182,285 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 64,050,881 - 64,052,213 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 66,862,143 - 66,863,476 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 66,862,143 - 66,863,476 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 66,594,524 - 66,595,857 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 66,046,220 - 66,047,553 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 66,065,272 - 66,066,576 (-) NCBI Celera 8 61,813,792 - 61,815,125 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
RPLP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 69,452,818 - 69,456,205 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 69,452,814 - 69,456,205 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 69,745,157 - 69,748,544 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 67,532,213 - 67,534,938 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 67,532,212 - 67,534,938 NCBI Celera 15 46,633,950 - 46,636,675 (+) NCBI Celera Cytogenetic Map 15 q23 NCBI HuRef 15 46,578,122 - 46,580,847 (+) NCBI HuRef CHM1_1 15 69,863,129 - 69,865,854 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 67,274,899 - 67,278,285 (+) NCBI T2T-CHM13v2.0
Rplp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 61,820,565 - 61,821,792 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 61,820,566 - 61,821,824 (-) Ensembl GRCm39 Ensembl GRCm38 9 61,913,283 - 61,914,510 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 61,913,284 - 61,914,542 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 61,761,090 - 61,762,317 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 61,711,289 - 61,712,516 (-) NCBI MGSCv36 mm8 Celera 9 59,135,851 - 59,137,078 (-) NCBI Celera Cytogenetic Map 9 B NCBI cM Map 9 33.5 NCBI
Rplp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 7,053,378 - 7,055,858 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 7,053,378 - 7,055,858 (-) NCBI ChiLan1.0 ChiLan1.0
RPLP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 58,717,382 - 58,720,048 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 62,881,235 - 62,884,112 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 48,403,415 - 48,406,149 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 67,173,833 - 67,176,570 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 67,173,832 - 67,176,570 (+) Ensembl panpan1.1 panPan2
RPLP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 33,342,099 - 33,346,541 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 33,277,907 - 33,280,870 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 33,543,714 - 33,546,678 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 33,491,545 - 33,546,709 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 33,469,120 - 33,472,087 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 33,530,796 - 33,533,761 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 33,778,695 - 33,781,669 (+) NCBI UU_Cfam_GSD_1.0
Rplp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 111,334,702 - 111,336,687 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 29,182,729 - 29,186,737 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 29,182,772 - 29,184,750 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPLP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 167,296,094 - 167,298,263 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 167,296,084 - 167,298,264 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 185,384,984 - 185,387,171 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPLP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 14,002,074 - 14,004,481 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 14,002,075 - 14,004,474 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 127,478,852 - 127,481,262 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rplp1
.
Predicted Target Of
Count of predictions: 102 Count of miRNA genes: 91 Interacting mature miRNAs: 96 Transcripts: ENSRNOT00000018820 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RPLP1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 8,431,994 - 8,432,082 (+) MAPPER mRatBN7.2 mRatBN7.2 8 62,395,183 - 62,395,271 (+) MAPPER mRatBN7.2 Rnor_6.0 8 66,863,319 - 66,863,406 NCBI Rnor6.0 Rnor_6.0 17 9,234,720 - 9,234,807 NCBI Rnor6.0 Rnor_5.0 17 11,393,529 - 11,393,616 UniSTS Rnor5.0 Rnor_5.0 8 66,595,700 - 66,595,787 UniSTS Rnor5.0 RGSC_v3.4 8 66,047,396 - 66,047,483 UniSTS RGSC3.4 RGSC_v3.4 17 14,407,913 - 14,408,000 UniSTS RGSC3.4 Celera 17 8,516,311 - 8,516,398 UniSTS Celera 8 61,814,968 - 61,815,055 UniSTS Cytogenetic Map 17 p14 UniSTS Cytogenetic Map 8 q24 UniSTS
PMC156124P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map X q31 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018820 ⟹ ENSRNOP00000018820
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 62,393,177 - 62,395,339 (-) Ensembl
RefSeq Acc Id:
NM_001007604 ⟹ NP_001007605
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 71,289,539 - 71,290,872 (-) NCBI mRatBN7.2 8 62,394,008 - 62,395,341 (-) NCBI Rnor_6.0 8 66,862,143 - 66,863,476 (-) NCBI Rnor_5.0 8 66,594,524 - 66,595,857 (-) NCBI RGSC_v3.4 8 66,046,220 - 66,047,553 (-) RGD Celera 8 61,813,792 - 61,815,125 (-) RGD
Sequence:
CCTTTCCTCAGCTGCCGCCAAGGTGCTCGGTCCTTCCGAGGAAGCTAAGGCCGCGTTGAGGTGAGGCCCTCACTTCATCCGGCGACTAGCACCGTGCCGGCAGTCCACAACATGGCTTCTGTCTCTGA
hide sequence
RefSeq Acc Id:
NP_001007605 ⟸ NM_001007604
- UniProtKB:
P19944 (UniProtKB/Swiss-Prot), A6J567 (UniProtKB/TrEMBL)
- Sequence:
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSAAAAPAEEKKVEAKKEESEESEDDMGFGLFD
hide sequence
Ensembl Acc Id:
ENSRNOP00000018820 ⟸ ENSRNOT00000018820
RGD ID: 13696048 Promoter ID: EPDNEW_R6573 Type: multiple initiation site Name: LOC100360522_1 Description: ribosomal protein P1-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 66,863,475 - 66,863,535 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Rplp1
ribosomal protein lateral stalk subunit P1
Rplp1
ribosomal protein, large, P1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Rplp1
ribosomal protein, large, P1
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Rplp1
ribosomal protein, large, P1
Symbol and Name status set to provisional
70820 PROVISIONAL
