Symbol:
Scn3b
Name:
sodium voltage-gated channel beta subunit 3
RGD ID:
621657
Description:
Predicted to enable sodium channel inhibitor activity; transmembrane transporter binding activity; and voltage-gated sodium channel activity involved in cardiac muscle cell action potential. Involved in nervous system development and sodium ion transport. Predicted to be located in several cellular components, including Z disc; cytosol; and plasma membrane. Predicted to be part of voltage-gated sodium channel complex. Human ortholog(s) of this gene implicated in Brugada syndrome 7. Orthologous to human SCN3B (sodium voltage-gated channel beta subunit 3); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Scnb3; sodium channel beta 3 subunit; sodium channel regulatory subunit beta-3; sodium channel subunit beta-3; sodium channel, voltage-gated, type III, beta; sodium channel, voltage-gated, type III, beta subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SCN3B (sodium voltage-gated channel beta subunit 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):
Scn3b (sodium channel, voltage-gated, type III, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Scn3b (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SCN3B (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SCN3B (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scn3b (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SCN3B (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SCN3B (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Scn3b (sodium voltage-gated channel beta subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Scn3b (sodium channel, voltage-gated, type III, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SCN3B (sodium voltage-gated channel beta subunit 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scn3b (sodium channel, voltage-gated, type III, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
scn3b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 49,527,529 - 49,550,019 (+) NCBI GRCr8 mRatBN7.2 8 40,630,372 - 40,652,869 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 40,630,455 - 40,652,868 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 46,138,136 - 46,160,555 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 44,416,727 - 44,439,130 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 42,284,327 - 42,306,725 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 44,136,413 - 44,159,011 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 44,136,496 - 44,159,010 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 61,379,751 - 61,402,348 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 43,231,453 - 43,254,066 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 43,240,218 - 43,262,831 (+) NCBI Celera 8 40,246,442 - 40,268,779 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Scn3b Rat Brugada syndrome ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Brugada syndrome | ClinVar Annotator: match by term: Sudden Unexplained more ... ClinVar PMID:20031595|PMID:21051419|PMID:22284586|PMID:23257389|PMID:23414114|PMID:23861362|PMID:24033266|PMID:24055113|PMID:24144883|PMID:25650408|PMID:25741868|PMID:25757662|PMID:28492532|PMID:29247119|PMID:30821013|PMID:31019283|PMID:31043699 Scn3b Rat Brugada syndrome 7 ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Atrial fibrillation, familial, 16 | ClinVar Annotator: match by term: more ... ClinVar PMID:16199547|PMID:17576681|PMID:20031595|PMID:20042427|PMID:20226894|PMID:20558140|PMID:21051419|PMID:22284586|PMID:23257389|PMID:23414114|PMID:23861362|PMID:24033266|PMID:24055113|PMID:24144883|PMID:24529773|PMID:25650408|PMID:25741868|PMID:25757662|PMID:26179811|PMID:27435932|PMID:27711072|PMID:27784853|PMID:28166811|PMID:28492532|PMID:29247119|PMID:30662450|PMID:30821013|PMID:30847666|PMID:31019283|PMID:31043699|PMID:34219138|PMID:9536098 Scn3b Rat Cardiac Arrhythmias ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Cardiac arrhythmia ClinVar PMID:25741868|PMID:27435932|PMID:28492532 Scn3b Rat cardiomyopathy ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Cardiomyopathy ClinVar PMID:23257389|PMID:23861362|PMID:24033266|PMID:25741868|PMID:27435932|PMID:27711072|PMID:28492532|PMID:30662450 Scn3b Rat cardiomyopathy ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Cardiomyopathy ClinVar PMID:23257389|PMID:23861362|PMID:24033266|PMID:25741868|PMID:27435932|PMID:27711072|PMID:27784853|PMID:28492532|PMID:30662450|PMID:34219138 Scn3b Rat chromosome 11 partial duplication syndrome ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Distal trisomy 11q ClinVar PMID:25741868 Scn3b Rat Dwarfism ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Short stature ClinVar PMID:32581362 Scn3b Rat holoprosencephaly 11 ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Holoprosencephaly 11 ClinVar PMID:28492532 Scn3b Rat Infant Death ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Death in infancy ClinVar PMID:23257389|PMID:23861362|PMID:24033266|PMID:25741868|PMID:27435932|PMID:27711072|PMID:27784853|PMID:28492532|PMID:30662450|PMID:34219138 Scn3b Rat long QT syndrome ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Long QT syndrome ClinVar PMID:25741868|PMID:28492532 Scn3b Rat schizophrenia ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Schizophrenia ClinVar PMID:21681106|PMID:30208311 Scn3b Rat Sudden Cardiac Death ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Sudden cardiac death ClinVar Scn3b Rat Sudden Unexpected Nocturnal Death Syndrome ISO RGD:1350710 8554872 ClinVar Annotator: match by term: Sudden unexpected nocturnal death syndrome ClinVar PMID:20031595|PMID:21051419|PMID:22284586|PMID:23257389|PMID:23414114|PMID:23861362|PMID:24033266|PMID:24055113|PMID:24144883|PMID:25650408|PMID:25741868|PMID:25757662|PMID:28492532|PMID:29247119|PMID:30821013|PMID:31019283|PMID:31043699
Only show annotations with direct experimental evidence (0 objects hidden)
Scn3b Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1332251 6480464 1,2-Dimethylhydrazine results in decreased expression of SCN3B mRNA CTD PMID:22206623 Scn3b Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of SCN3B mRNA CTD PMID:30723492 Scn3b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SCN3B mRNA CTD PMID:32109520 Scn3b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCN3B mRNA CTD PMID:34747641 Scn3b Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1332251 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of SCN3B mRNA CTD PMID:20188158 Scn3b Rat 3-methylcholanthrene multiple interactions ISO RGD:1350710 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to SCN3B promoter] CTD PMID:20348232 Scn3b Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Scn3b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SCN3B mRNA CTD PMID:24780913 Scn3b Rat actinomycin D multiple interactions ISO RGD:1350710 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of SCN3B mRNA CTD PMID:38460933 Scn3b Rat actinomycin D increases expression ISO RGD:1350710 6480464 Dactinomycin results in increased expression of SCN3B mRNA CTD PMID:38460933 Scn3b Rat aflatoxin B1 affects expression ISO RGD:1350710 6480464 Aflatoxin B1 affects the expression of SCN3B protein CTD PMID:20106945 Scn3b Rat all-trans-retinoic acid increases expression ISO RGD:1350710 6480464 Tretinoin results in increased expression of SCN3B mRNA CTD PMID:21934132 Scn3b Rat all-trans-retinoic acid multiple interactions ISO RGD:1332251 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SCN3B mRNA CTD PMID:36189433 Scn3b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SCN3B mRNA CTD PMID:16483693 Scn3b Rat arsane decreases expression ISO RGD:1332251 6480464 Arsenic results in decreased expression of SCN3B mRNA CTD PMID:19654921 Scn3b Rat arsenic atom decreases expression ISO RGD:1332251 6480464 Arsenic results in decreased expression of SCN3B mRNA CTD PMID:19654921 Scn3b Rat benzo[a]pyrene decreases expression ISO RGD:1332251 6480464 Benzo(a)pyrene results in decreased expression of SCN3B mRNA CTD PMID:21569818 Scn3b Rat benzo[a]pyrene increases expression ISO RGD:1350710 6480464 Benzo(a)pyrene results in increased expression of SCN3B mRNA CTD PMID:32234424 Scn3b Rat benzo[a]pyrene increases methylation ISO RGD:1350710 6480464 Benzo(a)pyrene results in increased methylation of SCN3B 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Scn3b Rat benzo[a]pyrene multiple interactions ISO RGD:1332251 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Scn3b Rat benzo[a]pyrene increases expression ISO RGD:1332251 6480464 Benzo(a)pyrene results in increased expression of SCN3B mRNA CTD PMID:22228805|PMID:22610609 Scn3b Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SCN3B mRNA CTD PMID:21839799 Scn3b Rat benzo[b]fluoranthene increases expression ISO RGD:1332251 6480464 benzo(b)fluoranthene results in increased expression of SCN3B mRNA CTD PMID:26377693 Scn3b Rat benzo[b]fluoranthene multiple interactions ISO RGD:1332251 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Scn3b Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SCN3B mRNA CTD PMID:20920545 Scn3b Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of SCN3B more ... CTD PMID:23359474|PMID:31199487 Scn3b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:23359474|PMID:36041667 Scn3b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SCN3B mRNA CTD PMID:25181051 Scn3b Rat bisphenol A decreases expression ISO RGD:1332251 6480464 bisphenol A results in decreased expression of SCN3B mRNA CTD PMID:26063408 Scn3b Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Scn3b Rat butanal increases expression ISO RGD:1350710 6480464 butyraldehyde results in increased expression of SCN3B mRNA CTD PMID:26079696 Scn3b Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487 Scn3b Rat camptothecin increases expression ISO RGD:1350710 6480464 Camptothecin results in increased expression of SCN3B mRNA CTD PMID:38460933 Scn3b Rat CGP 52608 multiple interactions ISO RGD:1350710 6480464 CGP 52608 promotes the reaction [RORA protein binds to SCN3B gene] CTD PMID:28238834 Scn3b Rat chloroprene decreases expression ISO RGD:1332251 6480464 Chloroprene results in decreased expression of SCN3B mRNA CTD PMID:23125180 Scn3b Rat chlorpyrifos increases expression ISO RGD:1332251 6480464 Chlorpyrifos results in increased expression of SCN3B mRNA CTD PMID:37019170 Scn3b Rat chrysene multiple interactions ISO RGD:1332251 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Scn3b Rat cisplatin increases expression ISO RGD:1350710 6480464 Cisplatin results in increased expression of SCN3B mRNA CTD PMID:21532991|PMID:27392435 Scn3b Rat cisplatin multiple interactions ISO RGD:1350710 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SCN3B mRNA CTD PMID:27392435 Scn3b Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SCN3B mRNA CTD PMID:26033743 Scn3b Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SCN3B mRNA CTD PMID:26033743 Scn3b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of SCN3B mRNA CTD PMID:26577399 Scn3b Rat cyclosporin A increases expression ISO RGD:1350710 6480464 Cyclosporine results in increased expression of SCN3B mRNA CTD PMID:20106945 Scn3b Rat cyfluthrin multiple interactions EXP 6480464 cyfluthrin affects the reaction [[SCN3A protein binds to SCN3B protein] which results in increased transport more ... CTD PMID:18538810 Scn3b Rat cypermethrin multiple interactions EXP 6480464 cypermethrin affects the reaction [[SCN3A protein binds to SCN3B protein] which results in increased transport more ... CTD PMID:18538810 Scn3b Rat DDE decreases expression ISO RGD:1350710 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SCN3B mRNA CTD PMID:38568856 Scn3b Rat dibenz[a,h]anthracene increases expression ISO RGD:1332251 6480464 1,2,5,6-dibenzanthracene results in increased expression of SCN3B mRNA CTD PMID:26377693 Scn3b Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SCN3B mRNA CTD PMID:21266533 Scn3b Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of SCN3B more ... CTD PMID:23359474|PMID:31199487 Scn3b Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487 Scn3b Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487 Scn3b Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487 Scn3b Rat doxorubicin decreases expression ISO RGD:1350710 6480464 Doxorubicin results in decreased expression of SCN3B mRNA CTD PMID:29803840 Scn3b Rat ethanol affects splicing ISO RGD:1332251 6480464 Ethanol affects the splicing of SCN3B mRNA CTD PMID:30319688 Scn3b Rat etoposide increases expression ISO RGD:1332251 6480464 Etoposide results in increased expression of SCN3B mRNA CTD PMID:25270620 Scn3b Rat fenpropathrin multiple interactions EXP 6480464 fenpropathrin affects the reaction [[SCN3A protein binds to SCN3B protein] which results in increased transport more ... CTD PMID:18538810 Scn3b Rat fenvalerate multiple interactions EXP 6480464 fenvalerate affects the reaction [[SCN3A protein binds to SCN3B protein] which results in increased transport more ... CTD PMID:18538810 Scn3b Rat folic acid decreases expression ISO RGD:1350710 6480464 Folic Acid results in decreased expression of SCN3B mRNA CTD PMID:21867686 Scn3b Rat fulvestrant decreases methylation ISO RGD:1350710 6480464 Fulvestrant results in decreased methylation of SCN3B gene CTD PMID:31601247 Scn3b Rat furan increases expression EXP 6480464 furan results in increased expression of SCN3B mRNA CTD PMID:27387713 Scn3b Rat genistein decreases expression ISO RGD:1332251 6480464 Genistein results in decreased expression of SCN3B mRNA CTD PMID:32186404 Scn3b Rat lead(0) affects expression ISO RGD:1350710 6480464 Lead affects the expression of SCN3B mRNA CTD PMID:28903495 Scn3b Rat Licochalcone B decreases expression ISO RGD:1350710 6480464 licochalcone B results in decreased expression of SCN3B mRNA CTD PMID:33647349 Scn3b Rat maneb multiple interactions ISO RGD:1332251 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SCN3B mRNA CTD PMID:36117858 Scn3b Rat manganese atom increases expression ISO RGD:1350710 6480464 Manganese results in increased expression of SCN3B mRNA CTD PMID:17175027 Scn3b Rat manganese(0) increases expression ISO RGD:1350710 6480464 Manganese results in increased expression of SCN3B mRNA CTD PMID:17175027 Scn3b Rat manganese(II) chloride increases expression ISO RGD:1350710 6480464 manganese chloride results in increased expression of SCN3B mRNA CTD PMID:17175027 Scn3b Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:1332251 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of SCN3B mRNA CTD PMID:36189433 Scn3b Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1332251 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SCN3B mRNA CTD PMID:36189433 Scn3b Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of SCN3B mRNA CTD PMID:20638522|PMID:33484710 Scn3b Rat Nutlin-3 multiple interactions ISO RGD:1350710 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of SCN3B mRNA CTD PMID:38460933 Scn3b Rat ozone decreases expression ISO RGD:1332251 6480464 Ozone results in decreased expression of SCN3B mRNA CTD PMID:17095637 Scn3b Rat ozone multiple interactions ISO RGD:1332251 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Scn3b Rat paracetamol increases expression ISO RGD:1350710 6480464 Acetaminophen results in increased expression of SCN3B mRNA CTD PMID:29067470 Scn3b Rat paraquat multiple interactions ISO RGD:1332251 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SCN3B mRNA CTD PMID:36117858 Scn3b Rat pirinixic acid increases expression ISO RGD:1332251 6480464 pirinixic acid results in increased expression of SCN3B mRNA CTD PMID:20813756 Scn3b Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of SCN3B mRNA CTD PMID:22431001 Scn3b Rat silicon dioxide increases expression ISO RGD:1350710 6480464 Silicon Dioxide results in increased expression of SCN3B mRNA CTD PMID:22300531 Scn3b Rat sodium arsenite increases expression ISO RGD:1350710 6480464 sodium arsenite results in increased expression of SCN3B mRNA CTD PMID:38568856 Scn3b Rat sodium arsenite decreases expression ISO RGD:1350710 6480464 sodium arsenite results in decreased expression of SCN3B mRNA CTD PMID:34032870 Scn3b Rat sodium atom multiple interactions EXP 6480464 [SCN3A protein binds to SCN3B protein] which results in increased transport of Sodium; cyfluthrin affects more ... CTD PMID:18538810 Scn3b Rat sodium fluoride decreases expression ISO RGD:1332251 6480464 Sodium Fluoride results in decreased expression of SCN3B mRNA CTD PMID:27862939 Scn3b Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of SCN3B mRNA CTD PMID:19281266 Scn3b Rat sunitinib increases expression ISO RGD:1350710 6480464 Sunitinib results in increased expression of SCN3B mRNA CTD PMID:31533062 Scn3b Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SCN3B protein CTD PMID:12629582 Scn3b Rat tetraphene multiple interactions ISO RGD:1332251 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Scn3b Rat titanium dioxide decreases expression ISO RGD:1332251 6480464 titanium dioxide results in decreased expression of SCN3B mRNA CTD PMID:29264374 Scn3b Rat titanium dioxide decreases methylation ISO RGD:1332251 6480464 titanium dioxide results in decreased methylation of SCN3B gene CTD PMID:35295148 Scn3b Rat triclosan increases expression ISO RGD:1350710 6480464 Triclosan results in increased expression of SCN3B mRNA CTD PMID:30510588 Scn3b Rat trimellitic anhydride decreases expression ISO RGD:1332251 6480464 trimellitic anhydride results in decreased expression of SCN3B mRNA CTD PMID:19042947 Scn3b Rat valproic acid increases expression ISO RGD:1350710 6480464 Valproic Acid results in increased expression of SCN3B mRNA CTD PMID:23179753 Scn3b Rat valproic acid affects expression ISO RGD:1350710 6480464 Valproic Acid affects the expression of SCN3B mRNA CTD PMID:25979313
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) camptothecin (ISO) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (ISO) chrysene (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyclosporin A (ISO) cyfluthrin (EXP) cypermethrin (EXP) DDE (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) doxorubicin (ISO) ethanol (ISO) etoposide (ISO) fenpropathrin (EXP) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) lead(0) (ISO) Licochalcone B (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) nitrofen (EXP) Nutlin-3 (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) pirinixic acid (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium atom (EXP) sodium fluoride (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP) tetraphene (ISO) titanium dioxide (ISO) triclosan (ISO) trimellitic anhydride (ISO) valproic acid (ISO)
Biological Process
atrial cardiac muscle cell action potential (IEA,ISO) cardiac conduction (IEA,ISO) cardiac muscle cell action potential involved in contraction (IEA,ISO) cardiac muscle contraction (IEA,ISO) membrane depolarization (IEA,ISO) membrane depolarization during action potential (IEA,ISO) membrane depolarization during cardiac muscle cell action potential (IBA,IEA,ISO) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) nervous system development (IEP) positive regulation of heart rate (IEA,ISO) positive regulation of sodium ion transport (IEA,ISO) protein localization to plasma membrane (IEA,ISO) regulation of atrial cardiac muscle cell membrane depolarization (IEA,ISO) regulation of heart rate by cardiac conduction (IBA,IEA,ISO) regulation of ventricular cardiac muscle cell membrane depolarization (IEA,ISO) SA node cell action potential (IEA,ISO) sodium ion transmembrane transport (IBA,IEA,ISO) sodium ion transport (IDA,IEA) ventricular cardiac muscle cell action potential (IBA,IEA,ISO)
1.
Human neuronal changes in brain edema and increased intracranial pressure.
Faragó N, etal., Acta Neuropathol Commun. 2016 Aug 4;4(1):78. doi: 10.1186/s40478-016-0356-x.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
beta 3: an additional auxiliary subunit of the voltage-sensitive sodium channel that modulates channel gating with distinct kinetics.
Morgan K, etal., Proc Natl Acad Sci U S A 2000 Feb 29;97(5):2308-13.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
Differential modulation of sodium channel gating and persistent sodium currents by the beta1, beta2, and beta3 subunits.
Qu Y, etal., Mol Cell Neurosci 2001 Nov;18(5):570-80.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.
Expression of auxiliary beta subunits of sodium channels in primary afferent neurons and the effect of nerve injury.
Takahashi N, etal., Neuroscience. 2003;121(2):441-50.
15.
Differential expression of neuronal voltage-gated sodium channel mRNAs during the development of the rat trigeminal ganglion.
Thun J, etal., Brain Res. 2009 May 7;1269:11-22. Epub 2009 Mar 6.
Scn3b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 49,527,529 - 49,550,019 (+) NCBI GRCr8 mRatBN7.2 8 40,630,372 - 40,652,869 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 40,630,455 - 40,652,868 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 46,138,136 - 46,160,555 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 44,416,727 - 44,439,130 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 42,284,327 - 42,306,725 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 44,136,413 - 44,159,011 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 44,136,496 - 44,159,010 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 61,379,751 - 61,402,348 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 43,231,453 - 43,254,066 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 43,240,218 - 43,262,831 (+) NCBI Celera 8 40,246,442 - 40,268,779 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
SCN3B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 123,629,188 - 123,654,624 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 123,629,187 - 123,655,244 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 123,499,896 - 123,525,332 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 123,005,105 - 123,030,525 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 123,007,132 - 123,030,522 NCBI Celera 11 120,659,315 - 120,684,712 (-) NCBI Celera Cytogenetic Map 11 q24.1 NCBI HuRef 11 119,441,120 - 119,466,515 (-) NCBI HuRef CHM1_1 11 123,386,094 - 123,411,515 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 123,658,164 - 123,683,597 (-) NCBI T2T-CHM13v2.0
Scn3b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 40,180,512 - 40,202,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 40,180,513 - 40,202,914 (+) Ensembl GRCm39 Ensembl GRCm38 9 40,269,216 - 40,291,618 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 40,269,217 - 40,291,618 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 40,076,801 - 40,099,203 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 40,019,969 - 40,041,678 (+) NCBI MGSCv36 mm8 Celera 9 37,506,998 - 37,529,283 (+) NCBI Celera Cytogenetic Map 9 A5.1 NCBI cM Map 9 21.42 NCBI
Scn3b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 24,388,366 - 24,412,604 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 24,391,764 - 24,412,912 (-) NCBI ChiLan1.0 ChiLan1.0
SCN3B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 124,329,243 - 124,354,342 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 125,433,875 - 125,458,948 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 118,460,860 - 118,486,563 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 122,377,643 - 122,403,065 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 122,377,643 - 122,403,063 (-) Ensembl panpan1.1 panPan2
SCN3B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 10,783,235 - 10,808,342 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 10,783,325 - 10,804,242 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 10,839,227 - 10,864,324 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 10,733,388 - 10,758,535 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 10,734,206 - 10,759,133 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 10,837,530 - 10,862,647 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 10,768,079 - 10,793,209 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 10,814,475 - 10,839,652 (+) NCBI UU_Cfam_GSD_1.0
Scn3b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 105,161,078 - 105,184,745 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936542 8,086,702 - 8,105,372 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936542 8,082,487 - 8,106,154 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCN3B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 50,508,880 - 50,583,712 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 50,508,194 - 50,532,432 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 55,796,544 - 55,873,092 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCN3B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 115,031,634 - 115,057,829 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 115,034,508 - 115,057,787 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 11,051,460 - 11,079,632 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scn3b
.
Predicted Target Of
Count of predictions: 410 Count of miRNA genes: 223 Interacting mature miRNAs: 301 Transcripts: ENSRNOT00000009367 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 61337 Bp22 Blood pressure QTL 22 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 42692818 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 70206 Alc20 Alcohol consumption QTL 20 2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 8 30848154 40713225 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
RH133093
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 40,652,644 - 40,652,834 (+) MAPPER mRatBN7.2 Rnor_6.0 8 44,158,787 - 44,158,976 NCBI Rnor6.0 Rnor_5.0 8 61,379,786 - 61,379,975 UniSTS Rnor5.0 RGSC_v3.4 8 43,253,842 - 43,254,031 UniSTS RGSC3.4 Celera 8 40,268,555 - 40,268,744 UniSTS RH 3.4 Map 8 361.92 UniSTS Cytogenetic Map 8 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
211
97
93
40
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087022 ⟹ ENSRNOP00000071448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 40,630,455 - 40,652,868 (+) Ensembl Rnor_6.0 Ensembl 8 44,136,496 - 44,159,010 (+) Ensembl
RefSeq Acc Id:
NM_139097 ⟹ NP_620797
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,612 - 49,550,019 (+) NCBI mRatBN7.2 8 40,630,455 - 40,652,869 (+) NCBI Rnor_6.0 8 44,136,496 - 44,159,011 (+) NCBI Rnor_5.0 8 61,379,751 - 61,402,348 (-) NCBI RGSC_v3.4 8 43,231,453 - 43,254,066 (+) RGD Celera 8 40,246,442 - 40,268,779 (+) RGD
Sequence:
CACATTCAGCCACGGGGTGGCCCTGGAGAGGGACGGTTTTGACCACCTAATCGTCCAGCATCGGGGCTTCGCAAGATCCAGGAACGCGCCCCACGGAAAGGGGTCCCTCGGTCTACCCATCCTCCACC
hide sequence
RefSeq Acc Id:
XM_006243102 ⟹ XP_006243164
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI mRatBN7.2 8 40,630,372 - 40,652,381 (+) NCBI Rnor_6.0 8 44,136,413 - 44,158,527 (+) NCBI Rnor_5.0 8 61,379,751 - 61,402,348 (-) NCBI
Sequence:
GGGGTGGGGAATGTGTGTCCAAGGGGGAGGGTCCGTAGCTACCAAGGCGGCCGAGTGCTGCCTGCGCATGTCAAGGCTAGCAACACATTCAGCCACGGGGTGGCCCTGGAGAGGGACGGTTTTGACCA
hide sequence
RefSeq Acc Id:
XM_006243103 ⟹ XP_006243165
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI mRatBN7.2 8 40,630,372 - 40,652,381 (+) NCBI Rnor_6.0 8 44,136,413 - 44,158,527 (+) NCBI Rnor_5.0 8 61,379,751 - 61,402,348 (-) NCBI
Sequence:
GGGGTGGGGAATGTGTGTCCAAGGGGGAGGGTCCGTAGCTACCAAGGCGGCCGAGTGCTGCCTGCGCATGTCAAGGCTAGCAACACATTCAGCCACGGGGTGGCCCTGGAGAGGGACGGTTTTGACCA
hide sequence
RefSeq Acc Id:
XM_017595466 ⟹ XP_017450955
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI mRatBN7.2 8 40,630,372 - 40,652,381 (+) NCBI Rnor_6.0 8 44,136,413 - 44,158,527 (+) NCBI
Sequence:
GGGGTGGGGAATGTGTGTCCAAGGGGGAGGGTCCGTAGCTACCAAGGCGGCCGAGTGCTGCCTG
hide sequence
RefSeq Acc Id:
XM_039080819 ⟹ XP_038936747
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI mRatBN7.2 8 40,630,372 - 40,652,381 (+) NCBI
RefSeq Acc Id:
XM_063264913 ⟹ XP_063120983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI
RefSeq Acc Id:
XM_063264914 ⟹ XP_063120984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,527,529 - 49,550,019 (+) NCBI
RefSeq Acc Id:
XM_063264915 ⟹ XP_063120985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 49,534,869 - 49,550,019 (+) NCBI
RefSeq Acc Id:
NP_620797 ⟸ NM_139097
- Peptide Label:
precursor
- UniProtKB:
Q9JK00 (UniProtKB/Swiss-Prot), A6J3Q2 (UniProtKB/TrEMBL)
- Sequence:
MPAFNRLLPLASLVLIYWVRVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEF
hide sequence
RefSeq Acc Id:
XP_006243165 ⟸ XM_006243103
- Peptide Label:
isoform X1
- UniProtKB:
Q9JK00 (UniProtKB/Swiss-Prot), A6J3Q2 (UniProtKB/TrEMBL)
- Sequence:
MPAFNRLLPLASLVLIYWVRVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEF
hide sequence
RefSeq Acc Id:
XP_006243164 ⟸ XM_006243102
- Peptide Label:
isoform X1
- UniProtKB:
Q9JK00 (UniProtKB/Swiss-Prot), A6J3Q2 (UniProtKB/TrEMBL)
- Sequence:
MPAFNRLLPLASLVLIYWVRVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEF
hide sequence
RefSeq Acc Id:
XP_017450955 ⟸ XM_017595466
- Peptide Label:
isoform X2
- Sequence:
MKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVF
hide sequence
Ensembl Acc Id:
ENSRNOP00000071448 ⟸ ENSRNOT00000087022
RefSeq Acc Id:
XP_038936747 ⟸ XM_039080819
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063120983 ⟸ XM_063264913
- Peptide Label:
isoform X1
- UniProtKB:
Q9JK00 (UniProtKB/Swiss-Prot), A6J3Q2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120984 ⟸ XM_063264914
- Peptide Label:
isoform X1
- UniProtKB:
Q9JK00 (UniProtKB/Swiss-Prot), A6J3Q2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120985 ⟸ XM_063264915
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Scn3b
sodium voltage-gated channel beta subunit 3
Scn3b
sodium channel, voltage-gated, type III, beta subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-03-13
Scn3b
sodium channel, voltage-gated, type III, beta subunit
Scn3b
sodium channel, voltage-gated, type III, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Scn3b
sodium channel, voltage-gated, type III, beta
Scnb3
sodium channel beta 3 subunit
Symbol and Name updated
1299863 APPROVED
2002-08-07
Scnb3
sodium channel beta 3 subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
inactivates sodium channel opening more slowly than beta 1 subunit
633985
