Advanced Search (OLGA)

Gene: Ubxn11 (UBX domain protein 11) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ubxn11

Name:

UBX domain protein 11

RGD ID:

620769

Description:

Predicted to enable ubiquitin binding activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be located in cytoplasm and cytoskeleton. Orthologous to human UBXN11 (UBX domain protein 11); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Soc; socius; UBX domain containing 5; UBX domain-containing protein 11; UBX domain-containing protein 5; Ubxd5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBXN11 (UBX domain protein 11)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ubxn11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ubxn11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBXN11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBXN11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ubxn11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBXN11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBXN11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ubxn11 (UBX domain protein 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CPN1 (carboxypeptidase N subunit 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	UBXN11 (UBX domain protein 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ubxn11 (UBX domain protein 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubxn11 (UBX domain protein 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ubxn11	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,613,411 - 151,637,274 (+)	NCBI		GRCr8
mRatBN7.2	5	146,329,666 - 146,353,529 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,329,842 - 146,353,526 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	149,032,588 - 149,056,308 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,802,155 - 150,825,876 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,788,803 - 150,812,523 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,332,993 - 152,356,647 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,333,043 - 152,356,890 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	156,018,753 - 156,042,876 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,853,129 - 152,876,718 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,863,167 - 152,886,756 (+)	NCBI
Celera	5	144,748,852 - 144,772,442 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubxn11	Rat	autosomal recessive hypercholesterolemia		ISO	UBXN11 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypercholesterolemia more ...	ClinVar	PMID:11326085 more ...
Ubxn11	Rat	lung small cell carcinoma		ISO	UBXN11 (Homo sapiens)	8554872	ClinVar more ...	ClinVar
Ubxn11	Rat	retinitis pigmentosa 59		ISO	UBXN11 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinitis pigmentosa 59	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubxn11	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of UBXN11 mRNA	CTD	PMID:22298810
Ubxn11	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ubxn11 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of UBXN11 mRNA	CTD	PMID:21570461
Ubxn11	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Ubxn11 (Mus musculus)	6480464	Fenretinide results in increased expression of UBXN11 mRNA	CTD	PMID:28973697
Ubxn11	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of UBXN11 mRNA	CTD	PMID:31881176
Ubxn11	Rat	acrylamide	decreases expression	ISO	UBXN11 (Homo sapiens)	6480464	Acrylamide results in decreased expression of UBXN11 mRNA	CTD	PMID:32763439
Ubxn11	Rat	aflatoxin B1	increases methylation	ISO	UBXN11 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of UBXN11 gene	CTD	PMID:27153756
Ubxn11	Rat	aflatoxin B1	decreases methylation	ISO	UBXN11 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of UBXN11 intron	CTD	PMID:30157460
Ubxn11	Rat	amiodarone	increases expression	ISO	UBXN11 (Homo sapiens)	6480464	Amiodarone results in increased expression of UBXN11 mRNA	CTD	PMID:19774075
Ubxn11	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of UBXN11 mRNA	CTD	PMID:38685447
Ubxn11	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of UBXN11 mRNA	CTD	PMID:16483693
Ubxn11	Rat	arsane	affects methylation	ISO	UBXN11 (Homo sapiens)	6480464	Arsenic affects the methylation of UBXN11 gene	CTD	PMID:25304211
Ubxn11	Rat	arsenic atom	affects methylation	ISO	UBXN11 (Homo sapiens)	6480464	Arsenic affects the methylation of UBXN11 gene	CTD	PMID:25304211
Ubxn11	Rat	benzo[a]pyrene	decreases expression	ISO	Ubxn11 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of UBXN11 mRNA	CTD	PMID:22228805
Ubxn11	Rat	benzo[a]pyrene	increases methylation	ISO	UBXN11 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of UBXN11 3' UTR	CTD	PMID:27901495
Ubxn11	Rat	benzo[a]pyrene	affects methylation	ISO	UBXN11 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of UBXN11 5' UTR	CTD	PMID:27901495
Ubxn11	Rat	beta-lapachone	decreases expression	ISO	UBXN11 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of UBXN11 mRNA	CTD	PMID:38218311
Ubxn11	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of UBXN11 mRNA	CTD	PMID:25181051
Ubxn11	Rat	bisphenol A	decreases methylation	ISO	UBXN11 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of UBXN11 gene	CTD	PMID:31601247
Ubxn11	Rat	bisphenol A	multiple interactions	ISO	UBXN11 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of UBXN11 gene	CTD	PMID:31601247
Ubxn11	Rat	bisphenol A	decreases expression	ISO	UBXN11 (Homo sapiens)	6480464	bisphenol A results in decreased expression of UBXN11 mRNA	CTD	PMID:31715268
Ubxn11	Rat	Butylbenzyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of UBXN11 mRNA	CTD	PMID:33453195
Ubxn11	Rat	carbon nanotube	decreases expression	ISO	Ubxn11 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Ubxn11	Rat	CGP 52608	multiple interactions	ISO	UBXN11 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to UBXN11 gene]	CTD	PMID:28238834
Ubxn11	Rat	cisplatin	increases expression	ISO	UBXN11 (Homo sapiens)	6480464	Cisplatin results in increased expression of UBXN11 mRNA	CTD	PMID:27594783
Ubxn11	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of UBXN11 mRNA	CTD	PMID:26577399
Ubxn11	Rat	dibenz[a,h]anthracene	decreases expression	ISO	Ubxn11 (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Ubxn11	Rat	dibutyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	diethyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	diisobutyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	diisononyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of UBXN11 mRNA	CTD	PMID:31199487 and PMID:37690569
Ubxn11	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of UBXN11 mRNA	CTD	PMID:30307764
Ubxn11	Rat	fulvestrant	multiple interactions	ISO	UBXN11 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of UBXN11 gene	CTD	PMID:31601247
Ubxn11	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of UBXN11 mRNA	CTD	PMID:25539665
Ubxn11	Rat	hydralazine	multiple interactions	ISO	UBXN11 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of UBXN11 mRNA	CTD	PMID:17183730
Ubxn11	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of UBXN11 mRNA	CTD	PMID:38685447
Ubxn11	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of UBXN11 gene	CTD	PMID:35440735
Ubxn11	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of UBXN11 mRNA	CTD	PMID:25729387
Ubxn11	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of UBXN11 mRNA	CTD	PMID:25729387
Ubxn11	Rat	paracetamol	decreases expression	ISO	UBXN11 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of UBXN11 mRNA	CTD	PMID:29067470
Ubxn11	Rat	silver atom	increases expression	ISO	Ubxn11 (Mus musculus)	6480464	Silver results in increased expression of UBXN11 mRNA	CTD	PMID:27131904
Ubxn11	Rat	silver(0)	increases expression	ISO	Ubxn11 (Mus musculus)	6480464	Silver results in increased expression of UBXN11 mRNA	CTD	PMID:27131904
Ubxn11	Rat	sodium fluoride	increases expression	ISO	Ubxn11 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of UBXN11 protein	CTD	PMID:28918527
Ubxn11	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of UBXN11 mRNA	CTD	PMID:23411599 and PMID:34492290
Ubxn11	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of UBXN11 mRNA	CTD	PMID:25729387
Ubxn11	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of UBXN11 mRNA	CTD	PMID:25729387
Ubxn11	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of UBXN11 mRNA	CTD	PMID:33387578
Ubxn11	Rat	triphenyl phosphate	affects expression	ISO	UBXN11 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of UBXN11 mRNA	CTD	PMID:37042841
Ubxn11	Rat	urethane	decreases expression	ISO	UBXN11 (Homo sapiens)	6480464	Urethane results in decreased expression of UBXN11 mRNA	CTD	PMID:28818685
Ubxn11	Rat	valproic acid	multiple interactions	ISO	UBXN11 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of UBXN11 mRNA	CTD	PMID:17183730
Ubxn11	Rat	valproic acid	increases methylation	ISO	UBXN11 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of UBXN11 gene	CTD	PMID:29154799
Ubxn11	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of UBXN11 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubxn11	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN000596256 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubxn11	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ubxn11	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ubxn11	Rat	cytoskeleton	located_in	IEA	UniProtKB-SubCell:SL-0090	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubxn11	Rat	protein binding	enables	ISO	UBXN11 (Homo sapiens)	1624291	UniProtKB:O43741 more ...	RGD	PMID:16189514 more ...
Ubxn11	Rat	protein binding	enables	ISO	UBXN11 (Homo sapiens) and UniProtKB:Q5T124-6	1624291	UniProtKB:O14964 more ...	RGD	PMID:29997244 and PMID:32296183
Ubxn11	Rat	ubiquitin binding	enables	IBA	PANTHER:PTN000596256 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.	Katoh H, etal., Mol Cell Biol 2002 May;22(9):2952-64.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Ubxn11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,613,411 - 151,637,274 (+)	NCBI		GRCr8
mRatBN7.2	5	146,329,666 - 146,353,529 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,329,842 - 146,353,526 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	149,032,588 - 149,056,308 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,802,155 - 150,825,876 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,788,803 - 150,812,523 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,332,993 - 152,356,647 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,333,043 - 152,356,890 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	156,018,753 - 156,042,876 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,853,129 - 152,876,718 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,863,167 - 152,886,756 (+)	NCBI
Celera	5	144,748,852 - 144,772,442 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

UBXN11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	26,282,282 - 26,318,355 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	26,281,328 - 26,318,363 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	26,608,773 - 26,644,846 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	26,481,360 - 26,517,343 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	26,292,916 - 26,317,278	NCBI
Celera	1	25,005,107 - 25,041,075 (-)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	24,863,104 - 24,898,855 (-)	NCBI		HuRef
CHM1_1	1	26,722,043 - 26,757,960 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	26,119,766 - 26,155,807 (-)	NCBI		T2T-CHM13v2.0

Ubxn11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	133,829,811 - 133,854,095 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	133,829,881 - 133,854,904 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	134,102,500 - 134,126,784 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	134,102,570 - 134,127,593 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	133,658,514 - 133,682,693 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	133,374,675 - 133,398,854 (+)	NCBI		MGSCv36	mm8
Celera	4	132,283,593 - 132,308,305 (+)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	66.5	NCBI

Ubxn11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	5,682,794 - 5,705,701 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	5,685,416 - 5,708,993 (-)	NCBI	ChiLan1.0	ChiLan1.0

UBXN11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	200,565,058 - 200,589,395 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	199,663,223 - 199,687,566 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	25,543,314 - 25,567,655 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	26,611,308 - 26,636,049 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	26,608,439 - 26,636,016 (-)	Ensembl	panpan1.1		panPan2

UBXN11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	73,714,722 - 73,736,716 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	73,714,808 - 73,736,697 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	70,291,389 - 70,313,388 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	74,277,711 - 74,300,222 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	74,277,797 - 74,304,593 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	71,102,663 - 71,124,696 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	72,108,317 - 72,130,495 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	73,112,152 - 73,134,399 (+)	NCBI		UU_Cfam_GSD_1.0

Ubxn11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	44,953,586 - 44,976,063 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	10,778,990 - 10,797,617 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	10,778,367 - 10,800,805 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UBXN11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	83,686,391 - 83,714,439 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	83,688,709 - 83,714,516 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

UBXN11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	106,465,967 - 106,491,483 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	106,465,966 - 106,491,466 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	9,929,438 - 9,954,930 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ubxn11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	10,318,040 - 10,337,959 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	10,318,744 - 10,341,269 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ubxn11
44 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	108
Count of miRNA genes:	91
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000021342
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

D4Bwg1540e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	146,353,345 - 146,353,517 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	152,356,464 - 152,356,635	NCBI	Rnor6.0
Rnor_5.0	5	156,042,693 - 156,042,864	UniSTS	Rnor5.0
RGSC_v3.4	5	152,876,537 - 152,876,708	UniSTS	RGSC3.4
Celera	5	144,772,261 - 144,772,432	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH125075

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	146,353,147 - 146,353,514 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	152,356,266 - 152,356,632	NCBI	Rnor6.0
Rnor_5.0	5	156,042,495 - 156,042,861	UniSTS	Rnor5.0
RGSC_v3.4	5	152,876,339 - 152,876,705	UniSTS	RGSC3.4
Celera	5	144,772,063 - 144,772,429	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_138853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB072920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC120071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021342 ⟹ ENSRNOP00000021342

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,329,842 - 146,353,526 (+)	Ensembl
Rnor_6.0 Ensembl	5	152,333,043 - 152,356,890 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100142 ⟹ ENSRNOP00000077621

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,334,566 - 146,353,526 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107239 ⟹ ENSRNOP00000093554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,329,910 - 146,353,524 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108876 ⟹ ENSRNOP00000081428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,329,919 - 146,353,526 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114327 ⟹ ENSRNOP00000077920

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,329,919 - 146,353,526 (+)	Ensembl

RefSeq Acc Id:

NM_138853 ⟹ NP_620208

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,682 - 151,637,272 (+)	NCBI
mRatBN7.2	5	146,329,937 - 146,353,527 (+)	NCBI
Rnor_6.0	5	152,333,055 - 152,356,645 (+)	NCBI
Rnor_5.0	5	156,018,753 - 156,042,876 (+)	NCBI
RGSC_v3.4	5	152,853,129 - 152,876,718 (+)	RGD
Celera	5	144,748,852 - 144,772,442 (+)	RGD

Sequence:

show sequence

CAAGATGGCGGCGCCGCGGGACGGCTCGCTGGCCCCGTGGAGTCCCTGACAGTGAACCCCAACACTGGAGCTATGAGCTCACCCCTGGCCTCTCTTAGCAAGACTCGGAAGGTGCCCTTAGAGTCGGA
GCCTGTGAATCCCGGGAGGCGAGGGATAAGAATCTACGGAGATGAAGATGAGGTGGACATGGTGAATGACGGACAGGACTCAGAAGAGAAGATCTCTCTCCCTTCCTGCTATGGAGGCATTGGTAGGC
AAGGCCTTATGATCCATGACTCGGAGTTGCTGACCTCCATGGCCAGGAAGCTGCAGGAGCTGGAGCAGCAGTTGAAGGCACGGAATGAGGAGATGCTGTCCAAGGAGCAGAAGATCCTGGCCCTGGAG
GATTTGGTGCAGACCCTCCAGCAGCACCAGAGCAGCACAACCAGGGAGGAGGAGCTGGAGACACAGTGCATTCAGCTGCAACGGCAGGTTGGAGAGATGGAGCGGTTCCTCAATGACTATGGCCTGCA
GTGGGTGGGCGAGCCCATGGACCAGGAGAACTCAGAGGGAAAGATAATCTCTGAAAGTGATGAGCGAGACTGGATGAAGGCCAAGAAGTTCTGGAAGCCAGGGGATTCCATTGTGCCCCCCGAGGTGG
ACTTCGACAGACTGCTGTCCAGTCTACAGGATCTGAGTGAGCTGGTGGTGGAGGGAGAGGCCCAGGTGACACCAGTACCTGGTGGGGCTCAGTTCCGTACTCTAGAGCCCATCCCGCTGAAGCTCTAC
CGGAATGGAATCATGATGTTCGATGGACCCTTCCGGCCCTTCTACGATCCCTACACGCAGCGCTGCCTCCGGGACATACTGGATGGCTTCTTTCCCTCAGAGCTGCAGCGGCTGTATCCTGATGGAGT
CCCCTTTAAGGTAAGCGACCTGCGAAATCAGGTCTACCCAGAGGACGGGCTGGGCCCATTCCCAGGTGAGGGTCGTGTGGTGGGCCGGCAGAAAATACGCAAGGTCACAGACAGGGTGGAGGAGACTT
CAGGCTCCAGGATGACTGCTGAGAAATTTCTGAACAGGCTTCCCAAGTGTGTAATCCGACAAGGCGAGGTGATTGACATCCGGGGCCCCATCAGGGACACCTTGCAGAACTGCTGCCCAATGCCTGTC
CGGATCCAGGAGATCATAGTGGAGACACCTGCCTTGGCCTCTGAGCGGCAGAGGACCCAGGAGTCGCCTAACATGCCAGTGCCTCCACTCTCCATGCTGCGCATCAAGTCCGAGAATGGGGAACAGGC
CTTCCTGTTAATGATGCGGCCTGAGGACACCATTGGTGACGTGCGAAACCTCTTAGCACAGGCCAGGGACATGGATTCAGCTGCCTTTGAAATCTTGAGCACCTTCCCACCCACAGTCTACCGGGATG
ACACAGTGACTCTGCAGGCCGCAGGCCTGGTTCCCAATGCAACACTGCTCTTACGGACTCGCAGGGTTCTGCCAGCGAACCCCAGCTTTGGGACTGATTCTGGCCCGGGCTCACTGCCCTGAATAAAG
TGGCGCCCCTGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006239005 ⟹ XP_006239067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,621,150 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,337,408 - 146,353,527 (+)	NCBI
Rnor_6.0	5	152,340,146 - 152,356,645 (+)	NCBI
Rnor_5.0	5	156,018,753 - 156,042,876 (+)	NCBI

Sequence:

show sequence

CAGAGGGCTAAAGGGGGTGTGGGTCCCCCTTGCTTGGATCCCAGGGAGAGCCTCTGTGAACAAT
GGCTCCTACTCTTCTTGCCGGCTGTGTTTAGACGATGCTCCCACTTTCAGCTAGCTGCCCCACTACTGGTATATCCCACATCTGTCCAGGACGGTTTAACCTCCAGCCACATGGTTAGGGATCTGGCC
AAGCCCCAGGCCATTCTGTGGCTAGAAACCCTCCAGTTTCCAGCAAGTGTGATGTCAGCAGGTCTGTGATTGAGGCTTAGAGACAGTGCCGGGCCTGAAGGGAGAAGTCAGTCTCCAGTCATCTGCTG
TCTTATCTGCATGCTCCAAAAAGGGCTGGGTTCCTTAGGAGGCCATTTCCCCAGAGGGAGGGTGGGCAGATAGGCACTGGGAGGGATCAGGAGTTGGTGATAAGGCTAGAACTTTCCATCGGATGTGA
CATCTTAAGCAACTTTAAGATCTTCCAGCTTCCCTGTCCTCTGAGGGGAGAGCAACAGGCTGGCGTGTTGTAAGGATTTGGCCTTATGATCCATGACTCGGAGTTGCTGACCTCCATGGCCAGGAAGC
TGCAGGAGCTGGAGCAGCAGTTGAAGGCACGGAATGAGGAGATGCTGTCCAAGGAGCAGAAGATCCTGGCCCTGGAGGATTTGGTGCAGACCCTCCAGCAGCACCAGAGCAGCACAACCAGGGAGGAG
GAGCTGGAGACACAGTGCATTCAGCTGCAACGGCAGGTTGGAGAGATGGAGCGGTTCCTCAATGACTATGGCCTGCAGTGGGTGGGCGAGCCCATGGACCAGGAGAACTCAGAGGGAAAGATAATCTC
TGAAAGTGATGAGCGAGACTGGATGAAGGCCAAGAAGTTCTGGAAGCCAGGGGATTCCATTGTGCCCCCCGAGGTGGACTTCGACAGACTGCTGTCCAGTCTACAGGATCTGAGTGAGCTGGTGGTGG
AGGGAGAGGCCCAGGTGACACCAGTACCTGGTGGGGCTCAGTTCCGTACTCTAGAGCCCATCCCGCTGAAGCTCTACCGGAATGGAATCATGATGTTCGATGGACCCTTCCGGCCCTTCTACGATCCC
TACACGCAGCGCTGCCTCCGGGACATACTGGATGGCTTCTTTCCCTCAGAGCTGCAGCGGCTGTATCCTGATGGAGTCCCCTTTAAGGTAAGCGACCTGCGAAATCAGGTCTACCCAGAGGACGGGCT
GGGCCCATTCCCAGGTGAGGGTCGTGTGGTGGGCCGGCAGAAAATACGCAAGGTCACAGACAGGGTGGAGGAGACTTCAGGCTCCAGGATGACTGCTGAGAAATTTCTGAACAGGCTTCCCAAGTGTG
TAATCCGACAAGGCGAGGTGATTGACATCCGGGGCCCCATCAGGGACACCTTGCAGAACTGCTGCCCAATGCCTGTCCGGATCCAGGAGATCATAGTGGAGACACCTGCCTTGGCCTCTGAGCGGCAG
AGGACCCAGGAGTCGCCTAACATGCCAGTGCCTCCACTCTCCATGCTGCGCATCAAGTCCGAGAATGGGGAACAGGCCTTCCTGTTAATGATGCGGCCTGAGGACACCATTGGTGACGTGCGAAACCT
CTTAGCACAGGCCAGGGACATGGATTCAGCTGCCTTTGAAATCTTGAGCACCTTCCCACCCACAGTCTACCGGGATGACACAGTGACTCTGCAGGCCGCAGGCCTGGTTCCCAATGCAACACTGCTCT
TACGGACTCGCAGGGTTCTGCCAGCGAACCCCAGCTTTGGGACTGATTCTGGCCCGGGCTCACTGCCCTGAATAAAGTGGCGCCCCTGA

hide sequence

RefSeq Acc Id:

XM_039109245 ⟹ XP_038965173

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,697 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,329,938 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_039109246 ⟹ XP_038965174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,411 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,329,666 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_039109247 ⟹ XP_038965175

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,694 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,329,938 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_039109248 ⟹ XP_038965176

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,620,839 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,337,407 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_039109249 ⟹ XP_038965177

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,621,150 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,337,407 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_039109250 ⟹ XP_038965178

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,695 - 151,637,274 (+)	NCBI
mRatBN7.2	5	146,329,938 - 146,353,527 (+)	NCBI

RefSeq Acc Id:

XM_063287144 ⟹ XP_063143214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,619,120 - 151,637,274 (+)	NCBI

RefSeq Acc Id:

XM_063287145 ⟹ XP_063143215

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,574 - 151,637,274 (+)	NCBI

RefSeq Acc Id:

XM_063287146 ⟹ XP_063143216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,574 - 151,637,274 (+)	NCBI

RefSeq Acc Id:

XM_063287147 ⟹ XP_063143217

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,574 - 151,637,274 (+)	NCBI

RefSeq Acc Id:

XM_063287148 ⟹ XP_063143218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,572 - 151,629,035 (+)	NCBI

RefSeq Acc Id:

XM_063287149 ⟹ XP_063143219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,572 - 151,634,044 (+)	NCBI

RefSeq Acc Id:

XR_010066341

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,613,574 - 151,636,768 (+)	NCBI


Protein RefSeqs	NP_620208	(Get FASTA)	NCBI Sequence Viewer
	XP_006239067	(Get FASTA)	NCBI Sequence Viewer
	XP_038965173	(Get FASTA)	NCBI Sequence Viewer
	XP_038965174	(Get FASTA)	NCBI Sequence Viewer
	XP_038965175	(Get FASTA)	NCBI Sequence Viewer
	XP_038965176	(Get FASTA)	NCBI Sequence Viewer
	XP_038965177	(Get FASTA)	NCBI Sequence Viewer
	XP_038965178	(Get FASTA)	NCBI Sequence Viewer
	XP_063143214	(Get FASTA)	NCBI Sequence Viewer
	XP_063143215	(Get FASTA)	NCBI Sequence Viewer
	XP_063143216	(Get FASTA)	NCBI Sequence Viewer
	XP_063143217	(Get FASTA)	NCBI Sequence Viewer
	XP_063143218	(Get FASTA)	NCBI Sequence Viewer
	XP_063143219	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78730	(Get FASTA)	NCBI Sequence Viewer
	BAB88905	(Get FASTA)	NCBI Sequence Viewer
	EDL80703	(Get FASTA)	NCBI Sequence Viewer
	EDL80704	(Get FASTA)	NCBI Sequence Viewer
	EDL80705	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000077621
	ENSRNOP00000077920
GenBank Protein	Q8R512	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620208 ⟸ NM_138853

- UniProtKB:

Q8R512 (UniProtKB/Swiss-Prot), A6IT02 (UniProtKB/TrEMBL), A0A8I5Y1D9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSPLASLSKTRKVPLESEPVNPGRRGIRIYGDEDEVDMVNDGQDSEEKISLPSCYGGIGRQGLMIHDSELLTSMARKLQELEQQLKARNEEMLSKEQKILALEDLVQTLQQHQSSTTREEELETQCI
QLQRQVGEMERFLNDYGLQWVGEPMDQENSEGKIISESDERDWMKAKKFWKPGDSIVPPEVDFDRLLSSLQDLSELVVEGEAQVTPVPGGAQFRTLEPIPLKLYRNGIMMFDGPFRPFYDPYTQRCLR
DILDGFFPSELQRLYPDGVPFKVSDLRNQVYPEDGLGPFPGEGRVVGRQKIRKVTDRVEETSGSRMTAEKFLNRLPKCVIRQGEVIDIRGPIRDTLQNCCPMPVRIQEIIVETPALASERQRTQESPN
MPVPPLSMLRIKSENGEQAFLLMMRPEDTIGDVRNLLAQARDMDSAAFEILSTFPPTVYRDDTVTLQAAGLVPNATLLLRTRRVLPANPSFGTDSGPGSLP

hide sequence

RefSeq Acc Id:	XP_006239067 ⟸ XM_006239005
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I5Y1D9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIHDSELLTSMARKLQELEQQLKARNEEMLSKEQKILALEDLVQTLQQHQSSTTREEELETQCIQLQRQVGEMERFLNDYGLQWVGEPMDQENSEGKIISESDERDWMKAKKFWKPGDSIVPPEVDFD RLLSSLQDLSELVVEGEAQVTPVPGGAQFRTLEPIPLKLYRNGIMMFDGPFRPFYDPYTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQVYPEDGLGPFPGEGRVVGRQKIRKVTDRVEETSGS RMTAEKFLNRLPKCVIRQGEVIDIRGPIRDTLQNCCPMPVRIQEIIVETPALASERQRTQESPNMPVPPLSMLRIKSENGEQAFLLMMRPEDTIGDVRNLLAQARDMDSAAFEILSTFPPTVYRDDTV TLQAAGLVPNATLLLRTRRVLPANPSFGTDSGPGSLP hide sequence

Ensembl Acc Id:

ENSRNOP00000021342 ⟸ ENSRNOT00000021342

RefSeq Acc Id:	XP_038965174 ⟸ XM_039109246
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038965175 ⟸ XM_039109247
- Peptide Label:	isoform X8

Protein Domains

SEP UBX

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R512-F1-model_v2	AlphaFold	Q8R512	1-485	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694128

Promoter ID:

EPDNEW_R4653

Type:

single initiation site

Name:

Ubxn11_1

Description:

UBX domain protein 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	152,333,048 - 152,333,108	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39596	BioCyc
Ensembl Genes	ENSRNOG00000015476	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000100142	ENTREZGENE
	ENSRNOT00000114327	ENTREZGENE
Gene3D-CATH	3.30.420.210	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134156	IMAGE-MGC_LOAD
InterPro	NSFL1C_SEP_dom_sf	UniProtKB/Swiss-Prot
	SEP_domain	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	UBX_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:192207	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93179	IMAGE-MGC_LOAD
NCBI Gene	192207	ENTREZGENE
PANTHER	UBX DOMAIN CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	UBX DOMAIN-CONTAINING PROTEIN 11	UniProtKB/Swiss-Prot
Pfam	SEP	UniProtKB/Swiss-Prot
	UBX	UniProtKB/Swiss-Prot
PhenoGen	Ubxn11	PhenoGen
PROSITE	SEP	UniProtKB/Swiss-Prot
	UBX	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015476	RatGTEx
Superfamily-SCOP	SSF102848	UniProtKB/Swiss-Prot
	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y1D9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y6V9_RAT	UniProtKB/TrEMBL
	A0A8I5ZSX6_RAT	UniProtKB/TrEMBL
	A0A8I6AJ03	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QB34	ENTREZGENE, UniProtKB/TrEMBL
	A6IT02	ENTREZGENE, UniProtKB/TrEMBL
	Q8R512	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Ubxn11	UBX domain protein 11	Ubxd5	UBX domain containing 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ubxd5	UBX domain containing 5	Soc	socius	Symbol and Name updated	1299863	APPROVED
2005-07-08	Soc	socius			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Soc	socius			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_cellular_localization	translocated to the cell periphery in the presence of Rnd1 and Rnd3 GTPases	634138

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar