Fez1 (fasciculation and elongation protein zeta 1) - Rat Genome Database

Fez1 (fasciculation and elongation protein zeta 1) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Fez1 (fasciculation and elongation protein zeta 1) Rattus norvegicus

{{ watchLinkText }}

Symbol:

Fez1

Name:

fasciculation and elongation protein zeta 1

RGD ID:

619708

Description:

Enables protein kinase C binding activity. Involved in several processes, including hippocampus development; positive regulation of anterograde axonal transport of mitochondrion; and positive regulation of neuron projection development. Located in dendrite; growth cone; and neuronal cell body. Biomarker of Parkinson's disease. Orthologous to human FEZ1 (fasciculation and elongation protein zeta 1); PARTICIPATES IN mitochondria transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

Previously known as:

fasciculation and elongation protein zeta 1 (zygin I); fasciculation and elongation protein zeta-1; MGC105385; protein kinase C-binding protein Zeta1; zygin I; zygin-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	44,733,288 - 44,778,519 (+)	NCBI		GRCr8
mRatBN7.2	8	36,544,462 - 36,589,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	36,544,535 - 36,589,683 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	40,554,068 - 40,599,499 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	38,837,136 - 38,882,569 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	36,700,025 - 36,745,464 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	39,305,128 - 39,350,270 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	39,305,128 - 39,350,270 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	39,307,579 - 39,353,313 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	38,078,328 - 38,123,983 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	38,087,093 - 38,132,749 (+)	NCBI
Celera	8	37,851,976 - 37,897,230 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	Parkinson's disease		IEP		13208826		RGD
Fez1	Rat	schizophrenia		ISO	RGD:732377	12790585	mRNA:decreased expression:hipocampus,dorsolateral prefrontal cortex:	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	chromosome 11 partial duplication syndrome		ISO	RGD:732377	8554872	ClinVar Annotator: match by term: Distal trisomy 11q	ClinVar	PMID:25741868
Fez1	Rat	Dwarfism		ISO	RGD:732377	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:32581362
Fez1	Rat	holoprosencephaly 11		ISO	RGD:732377	8554872	ClinVar Annotator: match by term: Holoprosencephaly 11	ClinVar	PMID:28492532
Fez1	Rat	Jacobsen Syndrome		ISO	RGD:732377	8554872	ClinVar Annotator: match by term: Paris-Trousseau thrombocytopenia	ClinVar	PMID:32581362
Fez1	Rat	schizophrenia		ISO	RGD:732377	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106\|PMID:30208311

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	(-)-demecolcine	increases expression	ISO	RGD:732377	6480464	Demecolcine results in increased expression of FEZ1 mRNA	CTD	PMID:23649840
Fez1	Rat	(S)-nicotine	increases expression	ISO	RGD:732377	6480464	Nicotine results in increased expression of FEZ1 mRNA	CTD	PMID:12588870
Fez1	Rat	(S)-nicotine	multiple interactions	ISO	RGD:732377	6480464	alpha-cobratoxin promotes the reaction [Nicotine results in decreased expression of FEZ1 mRNA alternative form]; Tubocurarine more ...	CTD	PMID:12588870
Fez1	Rat	(S)-nicotine	decreases expression	ISO	RGD:732377	6480464	Nicotine results in decreased expression of FEZ1 mRNA	CTD	PMID:12588870
Fez1	Rat	17beta-estradiol	decreases expression	ISO	RGD:732377	6480464	Estradiol results in decreased expression of FEZ1 mRNA	CTD	PMID:31614463
Fez1	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	RGD:732378	6480464	2,3',4,4',5-pentachlorobiphenyl results in increased expression of FEZ1 mRNA	CTD	PMID:31388691
Fez1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FEZ1 mRNA	CTD	PMID:33387578
Fez1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of FEZ1 mRNA	CTD	PMID:32109520
Fez1	Rat	2-methylcholine	affects expression	ISO	RGD:732377	6480464	beta-methylcholine affects the expression of FEZ1 mRNA	CTD	PMID:21179406
Fez1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:732378	6480464	Fenretinide results in increased expression of FEZ1 mRNA	CTD	PMID:28973697
Fez1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FEZ1 mRNA	CTD	PMID:30047161
Fez1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of FEZ1 mRNA	CTD	PMID:28959563
Fez1	Rat	actinomycin D	multiple interactions	ISO	RGD:732377	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FEZ1 mRNA	CTD	PMID:38460933
Fez1	Rat	actinomycin D	increases expression	ISO	RGD:732377	6480464	Dactinomycin results in increased expression of FEZ1 mRNA	CTD	PMID:38460933
Fez1	Rat	aflatoxin B1	increases expression	ISO	RGD:732377	6480464	Aflatoxin B1 results in increased expression of FEZ1 mRNA	CTD	PMID:27153756
Fez1	Rat	Aflatoxin B2 alpha	increases methylation	ISO	RGD:732377	6480464	aflatoxin B2 results in increased methylation of FEZ1 intron	CTD	PMID:30157460
Fez1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:732377	6480464	Tretinoin results in increased expression of FEZ1 mRNA	CTD	PMID:21934132
Fez1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of FEZ1 mRNA	CTD	PMID:30047161
Fez1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of FEZ1 mRNA	CTD	PMID:16483693
Fez1	Rat	antirheumatic drug	increases expression	ISO	RGD:732377	6480464	Antirheumatic Agents results in increased expression of FEZ1 mRNA	CTD	PMID:24449571
Fez1	Rat	aripiprazole	multiple interactions	ISO	RGD:732377	6480464	[Aripiprazole co-treated with Ozone] results in increased expression of FEZ1 mRNA	CTD	PMID:31476115
Fez1	Rat	aripiprazole	increases expression	ISO	RGD:732377	6480464	Aripiprazole results in increased expression of FEZ1 mRNA	CTD	PMID:31476115
Fez1	Rat	arsane	increases response to substance	ISO	RGD:732377	6480464	FEZ1 mRNA results in increased susceptibility to Arsenic	CTD	PMID:17976673
Fez1	Rat	arsenic atom	increases response to substance	ISO	RGD:732377	6480464	FEZ1 mRNA results in increased susceptibility to Arsenic	CTD	PMID:17976673
Fez1	Rat	arsenite(3-)	decreases methylation	ISO	RGD:732377	6480464	arsenite results in decreased methylation of FEZ1 promoter	CTD	PMID:23974009
Fez1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:732378	6480464	Benzo(a)pyrene results in increased expression of FEZ1 mRNA	CTD	PMID:22228805
Fez1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:732377	6480464	Benzo(a)pyrene affects the methylation of FEZ1 5' UTR; Benzo(a)pyrene affects the methylation of FEZ1 promoter	CTD	PMID:27901495\|PMID:30157460
Fez1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:732377	6480464	Diethylhexyl Phthalate results in decreased expression of FEZ1 mRNA	CTD	PMID:31163220
Fez1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	bisphenol A	increases expression	ISO	RGD:732378	6480464	bisphenol A results in increased expression of FEZ1 mRNA	CTD	PMID:26063408\|PMID:35479511
Fez1	Rat	bisphenol A	decreases expression	ISO	RGD:732378	6480464	bisphenol A results in decreased expression of FEZ1 mRNA	CTD	PMID:34585602
Fez1	Rat	bisphenol A	increases expression	ISO	RGD:732377	6480464	bisphenol A results in increased expression of FEZ1 mRNA	CTD	PMID:31715268
Fez1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FEZ1 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34947998
Fez1	Rat	bisphenol A	decreases expression	ISO	RGD:732377	6480464	bisphenol A results in decreased expression of FEZ1 mRNA	CTD	PMID:25912373
Fez1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FEZ1 mRNA	CTD	PMID:25181051
Fez1	Rat	butan-1-ol	multiple interactions	ISO	RGD:732377	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Fez1	Rat	butanal	increases expression	ISO	RGD:732377	6480464	butyraldehyde results in increased expression of FEZ1 mRNA	CTD	PMID:26079696
Fez1	Rat	Butylbenzyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	cadmium dichloride	decreases expression	ISO	RGD:732377	6480464	Cadmium Chloride results in decreased expression of FEZ1 mRNA	CTD	PMID:38382870\|PMID:38568856
Fez1	Rat	camptothecin	increases expression	ISO	RGD:732377	6480464	Camptothecin results in increased expression of FEZ1 mRNA	CTD	PMID:38460933
Fez1	Rat	carbon nanotube	decreases expression	ISO	RGD:732377	6480464	Nanotubes, Carbon results in decreased expression of FEZ1 mRNA	CTD	PMID:23634900
Fez1	Rat	casticin	decreases expression	ISO	RGD:732378	6480464	casticin results in decreased expression of FEZ1 mRNA	CTD	PMID:28444820
Fez1	Rat	choline	multiple interactions	ISO	RGD:732378	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fez1	Rat	cisplatin	multiple interactions	ISO	RGD:732377	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of FEZ1 mRNA	CTD	PMID:27392435
Fez1	Rat	cisplatin	increases expression	ISO	RGD:732377	6480464	Cisplatin results in increased expression of FEZ1 mRNA	CTD	PMID:27392435
Fez1	Rat	clobetasol	decreases expression	ISO	RGD:732378	6480464	Clobetasol results in decreased expression of FEZ1 mRNA	CTD	PMID:27462272
Fez1	Rat	crocidolite asbestos	decreases expression	ISO	RGD:732377	6480464	Asbestos, Crocidolite results in decreased expression of FEZ1 mRNA	CTD	PMID:23634900
Fez1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:732377	6480464	di-n-butylphosphoric acid affects the expression of FEZ1 mRNA	CTD	PMID:37042841
Fez1	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of FEZ1 mRNA	CTD	PMID:21266533
Fez1	Rat	dibutyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	diethyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	diisobutyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	diisononyl phthalate	multiple interactions	EXP		6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ...	CTD	PMID:31199487
Fez1	Rat	disodium selenite	increases expression	ISO	RGD:732377	6480464	Sodium Selenite results in increased expression of FEZ1 mRNA	CTD	PMID:18175754
Fez1	Rat	dorsomorphin	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	doxorubicin	decreases expression	ISO	RGD:732377	6480464	Doxorubicin results in decreased expression of FEZ1 mRNA	CTD	PMID:29803840
Fez1	Rat	ethanol	multiple interactions	ISO	RGD:732377	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Fez1	Rat	ethanol	affects splicing	ISO	RGD:732378	6480464	Ethanol affects the splicing of FEZ1 mRNA	CTD	PMID:30319688
Fez1	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:732377	6480464	Ethyl Methanesulfonate results in increased expression of FEZ1 mRNA	CTD	PMID:23649840
Fez1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of FEZ1 mRNA	CTD	PMID:30307764
Fez1	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of FEZ1 mRNA	CTD	PMID:18035473
Fez1	Rat	folic acid	multiple interactions	ISO	RGD:732378	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fez1	Rat	formaldehyde	increases expression	ISO	RGD:732377	6480464	Formaldehyde results in increased expression of FEZ1 mRNA	CTD	PMID:23649840
Fez1	Rat	hydrogen peroxide	affects expression	ISO	RGD:732377	6480464	Hydrogen Peroxide affects the expression of FEZ1 mRNA	CTD	PMID:21179406
Fez1	Rat	isobutanol	multiple interactions	ISO	RGD:732377	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ...	CTD	PMID:29432896
Fez1	Rat	L-methionine	multiple interactions	ISO	RGD:732378	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Fez1	Rat	maneb	multiple interactions	ISO	RGD:732378	6480464	[LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of more ...	CTD	PMID:23017109
Fez1	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of FEZ1 mRNA	CTD	PMID:28801915
Fez1	Rat	Mecamylamine	decreases expression	ISO	RGD:732377	6480464	Mecamylamine results in decreased expression of FEZ1 mRNA alternative form	CTD	PMID:12588870
Fez1	Rat	mercury dibromide	decreases expression	ISO	RGD:732377	6480464	mercuric bromide results in decreased expression of FEZ1 mRNA	CTD	PMID:26272509
Fez1	Rat	mercury dibromide	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of FEZ1 mRNA	CTD	PMID:30047161
Fez1	Rat	methyl methanesulfonate	increases expression	ISO	RGD:732377	6480464	Methyl Methanesulfonate results in increased expression of FEZ1 mRNA	CTD	PMID:23649840
Fez1	Rat	methylmercury chloride	affects expression	EXP		6480464	methylmercuric chloride affects the expression of FEZ1 mRNA	CTD	PMID:20864626
Fez1	Rat	methylmercury chloride	decreases expression	ISO	RGD:732377	6480464	methylmercuric chloride results in decreased expression of FEZ1 mRNA	CTD	PMID:28001369
Fez1	Rat	methylseleninic acid	increases expression	ISO	RGD:732377	6480464	methylselenic acid results in increased expression of FEZ1 mRNA	CTD	PMID:18548127
Fez1	Rat	N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine	increases expression	ISO	RGD:732377	6480464	N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine results in increased expression of FEZ1 mRNA	CTD	PMID:12756304
Fez1	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of FEZ1 mRNA	CTD	PMID:28801915
Fez1	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:732378	6480464	Diethylnitrosamine results in increased expression of FEZ1 mRNA	CTD	PMID:17854601
Fez1	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:732378	6480464	RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of FEZ1 mRNA]	CTD	PMID:17854601
Fez1	Rat	nicotine	increases expression	ISO	RGD:732377	6480464	Nicotine results in increased expression of FEZ1 mRNA	CTD	PMID:12588870
Fez1	Rat	nicotine	multiple interactions	ISO	RGD:732377	6480464	alpha-cobratoxin promotes the reaction [Nicotine results in decreased expression of FEZ1 mRNA alternative form]; Tubocurarine more ...	CTD	PMID:12588870
Fez1	Rat	nicotine	decreases expression	ISO	RGD:732377	6480464	Nicotine results in decreased expression of FEZ1 mRNA	CTD	PMID:12588870
Fez1	Rat	Nutlin-3	multiple interactions	ISO	RGD:732377	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FEZ1 mRNA	CTD	PMID:38460933
Fez1	Rat	Nutlin-3	increases expression	ISO	RGD:732377	6480464	nutlin 3 results in increased expression of FEZ1 mRNA	CTD	PMID:38460933
Fez1	Rat	ozone	multiple interactions	ISO	RGD:732377	6480464	[Aripiprazole co-treated with Ozone] results in increased expression of FEZ1 mRNA	CTD	PMID:31476115
Fez1	Rat	ozone	increases expression	ISO	RGD:732377	6480464	Ozone results in increased expression of FEZ1 mRNA	CTD	PMID:31476115
Fez1	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:732377	6480464	p-Chloromercuribenzoic Acid results in decreased expression of FEZ1 mRNA	CTD	PMID:26272509
Fez1	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	panobinostat	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Fez1	Rat	panobinostat	decreases expression	ISO	RGD:732377	6480464	panobinostat results in decreased expression of FEZ1 mRNA	CTD	PMID:26272509
Fez1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of FEZ1 mRNA	CTD	PMID:33387578
Fez1	Rat	paraquat	multiple interactions	ISO	RGD:732378	6480464	[LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of more ...	CTD	PMID:23017109
Fez1	Rat	pentanal	increases expression	ISO	RGD:732377	6480464	pentanal results in increased expression of FEZ1 mRNA	CTD	PMID:26079696
Fez1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:732378	6480464	perfluorohexanesulfonic acid results in increased expression of FEZ1 mRNA	CTD	PMID:37995155
Fez1	Rat	phenylmercury acetate	decreases expression	ISO	RGD:732377	6480464	Phenylmercuric Acetate results in decreased expression of FEZ1 mRNA	CTD	PMID:26272509
Fez1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of FEZ1 mRNA	CTD	PMID:30047161
Fez1	Rat	propanal	increases expression	ISO	RGD:732377	6480464	propionaldehyde results in increased expression of FEZ1 mRNA	CTD	PMID:26079696
Fez1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	decreases expression	ISO	RGD:732377	6480464	S-(1,2-dichlorovinyl)cysteine results in decreased expression of FEZ1 mRNA	CTD	PMID:35811015
Fez1	Rat	SB 431542	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	silicon dioxide	decreases expression	ISO	RGD:732377	6480464	Silicon Dioxide analog results in decreased expression of FEZ1 mRNA	CTD	PMID:25895662
Fez1	Rat	sodium arsenite	affects methylation	ISO	RGD:732377	6480464	sodium arsenite affects the methylation of FEZ1 gene	CTD	PMID:28589171
Fez1	Rat	succimer	multiple interactions	ISO	RGD:732377	6480464	[Succimer co-treated with Magnetite Nanoparticles] results in increased expression of FEZ1 mRNA	CTD	PMID:26378955
Fez1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of FEZ1 mRNA	CTD	PMID:30047161
Fez1	Rat	sunitinib	increases expression	ISO	RGD:732377	6480464	Sunitinib results in increased expression of FEZ1 mRNA	CTD	PMID:31533062
Fez1	Rat	temozolomide	increases expression	ISO	RGD:732377	6480464	Temozolomide results in increased expression of FEZ1 mRNA	CTD	PMID:31758290
Fez1	Rat	testosterone enanthate	affects expression	ISO	RGD:732377	6480464	testosterone enanthate affects the expression of FEZ1 mRNA	CTD	PMID:17440010
Fez1	Rat	tetrachloroethene	decreases expression	ISO	RGD:732378	6480464	Tetrachloroethylene results in decreased expression of FEZ1 mRNA	CTD	PMID:28973375
Fez1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of FEZ1 mRNA	CTD	PMID:31150632
Fez1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FEZ1 mRNA	CTD	PMID:33387578
Fez1	Rat	trichostatin A	increases expression	ISO	RGD:732377	6480464	trichostatin A results in increased expression of FEZ1 mRNA	CTD	PMID:24935251
Fez1	Rat	trichostatin A	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	trichostatin A	decreases expression	ISO	RGD:732377	6480464	trichostatin A results in decreased expression of FEZ1 mRNA	CTD	PMID:24935251\|PMID:26272509
Fez1	Rat	triclosan	decreases expression	ISO	RGD:732377	6480464	Triclosan results in decreased expression of FEZ1 mRNA	CTD	PMID:30510588
Fez1	Rat	triphenyl phosphate	affects expression	ISO	RGD:732377	6480464	triphenyl phosphate affects the expression of FEZ1 mRNA	CTD	PMID:37042841
Fez1	Rat	tubocurarine	multiple interactions	ISO	RGD:732377	6480464	Tubocurarine promotes the reaction [Nicotine results in decreased expression of FEZ1 mRNA]	CTD	PMID:12588870
Fez1	Rat	tubocurarine	decreases expression	ISO	RGD:732377	6480464	Tubocurarine results in decreased expression of FEZ1 mRNA	CTD	PMID:12588870
Fez1	Rat	valproic acid	affects expression	ISO	RGD:732378	6480464	Valproic Acid affects the expression of FEZ1 mRNA	CTD	PMID:17292431
Fez1	Rat	valproic acid	increases expression	ISO	RGD:732377	6480464	Valproic Acid results in increased expression of FEZ1 mRNA	CTD	PMID:19101580\|PMID:23179753\|PMID:24935251\|PMID:27188386\|PMID:29154799
Fez1	Rat	valproic acid	multiple interactions	ISO	RGD:732377	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Fez1	Rat	valproic acid	decreases expression	ISO	RGD:732377	6480464	Valproic Acid results in decreased expression of FEZ1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509
Fez1	Rat	valproic acid	affects expression	ISO	RGD:732377	6480464	Valproic Acid affects the expression of FEZ1 mRNA	CTD	PMID:25979313
Fez1	Rat	valproic acid	increases expression	ISO	RGD:732378	6480464	Valproic Acid results in increased expression of FEZ1 mRNA	CTD	PMID:19136453\|PMID:21427059
Fez1	Rat	zinc sulfate	decreases expression	ISO	RGD:732377	6480464	Zinc Sulfate results in decreased expression of FEZ1 mRNA	CTD	PMID:12756304
Fez1	Rat	zoledronic acid	increases expression	ISO	RGD:732377	6480464	zoledronic acid results in increased expression of FEZ1 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	cellular response to growth factor stimulus		IEP		2316312		RGD
Fez1	Rat	establishment of cell polarity		IMP		13208824		RGD
Fez1	Rat	establishment of mitochondrion localization		IMP		2316312		RGD
Fez1	Rat	hippocampus development		IEP		13208825		RGD
Fez1	Rat	mitochondrion organization		IMP		13208824		RGD
Fez1	Rat	negative regulation of autophagosome assembly	involved_in	ISS	UniProtKB:Q99689	1600115	GO_REF:0000024	GO_Central	GO_REF:0000024
Fez1	Rat	negative regulation of autophagosome assembly	involved_in	IEA	UniProtKB:Q99689\|ensembl:ENSP00000278919	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fez1	Rat	negative regulation of autophagosome assembly	involved_in	ISO	RGD:732377	1624291	PMID:25495476	RGD	PMID:25495476
Fez1	Rat	positive regulation of anterograde axonal transport of mitochondrion		IMP		13208824		RGD
Fez1	Rat	positive regulation of neuron projection development		IMP		2316312		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	axon		IDA		2316311		RGD
Fez1	Rat	axon	is_active_in	IBA	PANTHER:PTN000273571\|RGD:619708\|WB:WBGene00006808	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fez1	Rat	axon		IDA		13208824		RGD
Fez1	Rat	cell projection		IDA		2316311		RGD
Fez1	Rat	centrosome	located_in	IEA	UniProtKB:Q8K0X8\|ensembl:ENSMUSP00000034630	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fez1	Rat	centrosome	located_in	IEA	UniProtKB-SubCell:SL-0048	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fez1	Rat	centrosome	located_in	ISO	RGD:732378	1624291	PMID:15649943	RGD	PMID:15649943
Fez1	Rat	cytoplasm	is_active_in	IBA	MGI:2670976\|PANTHER:PTN000273571\|UniProtKB:Q99689\|WB:WBGene00006808	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fez1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q8K0X8\|ensembl:ENSMUSP00000034630	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fez1	Rat	cytoplasm	located_in	ISO	RGD:732378	1624291	PMID:15649943	RGD	PMID:15649943
Fez1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fez1	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fez1	Rat	dendrite		IDA		2316311		RGD
Fez1	Rat	dendrite		IDA		13208824		RGD
Fez1	Rat	Golgi apparatus	located_in	IEA	UniProtKB:Q99689\|ensembl:ENSP00000278919	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fez1	Rat	Golgi apparatus	located_in	ISO	RGD:732377	1624291	PMID:25495476	RGD	PMID:25495476
Fez1	Rat	growth cone		IDA		13208828		RGD
Fez1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fez1	Rat	microtubule	located_in	IEA	UniProtKB-KW:KW-0493	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fez1	Rat	neuronal cell body		IDA		13208824		RGD
Fez1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fez1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	gamma-tubulin binding	enables	IEA	UniProtKB:Q8K0X8\|ensembl:ENSMUSP00000034630	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fez1	Rat	gamma-tubulin binding	enables	ISO	RGD:732378	1624291	PMID:15649943	RGD	PMID:15649943
Fez1	Rat	protein binding		IPI	RGD:621559	2316312		RGD
Fez1	Rat	protein binding	enables	ISO	RGD:732378	1624291	PR:P25233\|PR:Q9QZ04 PMID:15649943	RGD	PMID:15649943
Fez1	Rat	protein binding	enables	ISO	RGD:732377	1624291	UniProtKB:O14530\|UniProtKB:P17210\|UniProtKB:P42858\|UniProtKB:Q96PY6\|UniProtKB:Q9P2H0\|UniProtKB:Q9UIL1 PMID:14690447, PMID:15383276, PMID:16169070, PMID:17500595, PMID:20547877, PMID:22354037, PMID:28514442, PMID:33961781	RGD	PMID:14690447\|PMID:15383276\|PMID:16169070\|PMID:17500595\|PMID:20547877\|PMID:22354037\|PMID:28514442\|PMID:33961781
Fez1	Rat	protein binding		IPI	RGD:3399	728650		RGD
Fez1	Rat	protein kinase C binding		IPI	RGD:3399	728650		RGD

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fez1	Rat	mitochondria transport pathway		ISO	RGD:732377	10402141		RGD

Disease Annotations Click to see Annotation Detail View

chromosome 11 partial duplication syndrome (ISO)

holoprosencephaly 11 (ISO)

Jacobsen Syndrome (ISO)

Parkinson's disease (IEP)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-methylcholine (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

butan-1-ol (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

clobetasol (ISO)

crocidolite asbestos (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

fenvalerate (EXP)

flavonoids (EXP)

folic acid (ISO)

formaldehyde (ISO)

hydrogen peroxide (ISO)

isobutanol (ISO)

L-methionine (ISO)

maneb (ISO)

manganese(II) chloride (EXP)

Mecamylamine (ISO)

mercury dibromide (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (EXP,ISO)

methylseleninic acid (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

phenylmercury acetate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

tubocurarine (ISO)

valproic acid (ISO)

zinc sulfate (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to growth factor stimulus (IEP)

establishment of cell polarity (IMP)

establishment of mitochondrion localization (IMP)

hippocampus development (IEP)

mitochondrion organization (IMP)

negative regulation of autophagosome assembly (IEA,ISO,ISS)

positive regulation of anterograde axonal transport of mitochondrion (IMP)

positive regulation of neuron projection development (IMP)

Cellular Component

axon (IBA,IDA)

cell projection (IDA)

centrosome (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

cytoskeleton (IEA)

Golgi apparatus (IEA,ISO)

growth cone (IDA)

microtubule (IEA)

neuronal cell body (IDA)

plasma membrane (IEA)

Molecular Function

gamma-tubulin binding (IEA,ISO)

protein binding (IPI,ISO)

protein kinase C binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

mitochondria transport pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Axonal guidance protein FEZ1 associates with tubulin and kinesin motor protein to transport mitochondria in neurites of NGF-stimulated PC12 cells.	Fujita T, etal., Biochem Biophys Res Commun. 2007 Sep 28;361(3):605-10. Epub 2007 Jul 23.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Expression of fasciculation and elongation protein zeta-1 (FEZ1) in cultured rat neonatal astrocytes.	He J, etal., Mol Cell Biochem. 2009 May;325(1-2):159-67. Epub 2009 Feb 8.
5.	Expression of fasciculation and elongation protein zeta-1 (FEZ1) in the developing rat brain.	Honda A, etal., Brain Res Mol Brain Res. 2004 Mar 17;122(1):89-92.
6.	Fasciculation and elongation protein zeta-1 (FEZ1) participates in the polarization of hippocampal neuron by controlling the mitochondrial motility.	Ikuta J, etal., Biochem Biophys Res Commun. 2007 Feb 2;353(1):127-32. Epub 2006 Dec 6.
7.	Mammalian homologue of the Caenorhabditis elegans UNC-76 protein involved in axonal outgrowth is a protein kinase C zeta-interacting protein.	Kuroda S, etal., J Cell Biol 1999 Feb 8;144(3):403-11.
8.	Regulation of mitochondrial transport in neurons.	Lin MY and Sheng ZH, Exp Cell Res. 2015 May 15;334(1):35-44. doi: 10.1016/j.yexcr.2015.01.004. Epub 2015 Jan 19.
9.	Expression of DISC1 binding partners is reduced in schizophrenia and associated with DISC1 SNPs.	Lipska BK, etal., Hum Mol Genet. 2006 Apr 15;15(8):1245-58. Epub 2006 Mar 1.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Disrupted-In-Schizophrenia 1, a candidate gene for schizophrenia, participates in neurite outgrowth.	Miyoshi K, etal., Mol Psychiatry. 2003 Jul;8(7):685-94.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Fasciculation and elongation protein zeta-1 (FEZ1) expression in reactive astrocytes in a rat model of Parkinson's disease.	Sun YY, etal., Neuropathol Appl Neurobiol. 2014 Feb;40(2):164-76. doi: 10.1111/nan.12077.

Additional References at PubMed

PMID:12477932	PMID:15466860	PMID:15489334	PMID:15649943	PMID:15843383	PMID:15879557	PMID:19667186	PMID:25495476	PMID:27247180	PMID:31774489	PMID:33395696	PMID:33771901

Genomics

Comparative Map Data

Fez1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	44,733,288 - 44,778,519 (+)	NCBI		GRCr8
mRatBN7.2	8	36,544,462 - 36,589,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	36,544,535 - 36,589,683 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	40,554,068 - 40,599,499 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	38,837,136 - 38,882,569 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	36,700,025 - 36,745,464 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	39,305,128 - 39,350,270 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	39,305,128 - 39,350,270 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	39,307,579 - 39,353,313 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	38,078,328 - 38,123,983 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	38,087,093 - 38,132,749 (+)	NCBI
Celera	8	37,851,976 - 37,897,230 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

FEZ1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	125,442,881 - 125,496,265 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	125,442,881 - 125,592,568 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	125,312,777 - 125,366,161 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	124,820,858 - 124,871,333 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	124,863,305 - 124,871,333	NCBI
Celera	11	122,475,971 - 122,526,454 (-)	NCBI		Celera
Cytogenetic Map	11	q24.2	NCBI
HuRef	11	121,257,207 - 121,307,713 (-)	NCBI		HuRef
CHM1_1	11	125,201,870 - 125,252,371 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	125,471,573 - 125,524,945 (-)	NCBI		T2T-CHM13v2.0

Fez1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	36,732,694 - 36,790,220 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	36,733,160 - 36,790,220 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	36,821,398 - 36,878,926 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	36,821,864 - 36,878,924 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	36,651,244 - 36,686,225 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	36,582,480 - 36,628,593 (+)	NCBI		MGSCv36	mm8
Celera	9	34,040,032 - 34,083,023 (+)	NCBI		Celera
Cytogenetic Map	9	A4	NCBI
cM Map	9	20.69	NCBI

Fez1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	26,477,301 - 26,531,354 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	26,477,995 - 26,530,686 (-)	NCBI	ChiLan1.0	ChiLan1.0

FEZ1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	126,140,622 - 126,191,057 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	127,245,630 - 127,296,035 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	120,272,187 - 120,322,600 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	124,186,241 - 124,236,403 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	124,182,901 - 124,236,403 (-)	Ensembl	panpan1.1		panPan2

FEZ1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	9,001,927 - 9,044,330 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	9,001,989 - 9,044,332 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	9,045,434 - 9,088,812 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	8,940,817 - 8,984,967 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	8,940,786 - 8,984,968 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	9,012,637 - 9,056,170 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	8,982,968 - 9,026,843 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	9,019,529 - 9,062,951 (+)	NCBI		UU_Cfam_GSD_1.0

Fez1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	107,623,764 - 107,669,772 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936743	1,871,664 - 1,903,245 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936743	1,871,808 - 1,917,370 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FEZ1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	52,621,183 - 52,672,660 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	52,621,175 - 52,672,660 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	58,321,965 - 58,348,192 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FEZ1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	116,617,835 - 116,668,601 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	116,617,714 - 116,668,574 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	9,401,860 - 9,506,604 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fez1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624927	1,469,025 - 1,512,790 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624927	1,470,218 - 1,512,780 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

.

Variants in Fez1
345 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	54
Count of miRNA genes:	44
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000008285
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	42692818	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	30848154	40713225	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat

Markers in Region

D8Rat47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	44,750,928 - 44,751,051 (+)	Marker Load Pipeline
mRatBN7.2	8	36,562,090 - 36,562,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	39,322,676 - 39,322,798	NCBI	Rnor6.0
Rnor_5.0	8	39,325,280 - 39,325,402	UniSTS	Rnor5.0
RGSC_v3.4	8	38,096,366 - 38,096,488	UniSTS	RGSC3.4
RGSC_v3.4	8	38,096,365 - 38,096,488	RGD	RGSC3.4
RGSC_v3.1	8	38,105,132 - 38,105,254	RGD
Celera	8	37,879,500 - 37,879,622	UniSTS
RH 3.4 Map	8	311.3	RGD
RH 3.4 Map	8	311.3	UniSTS
RH 2.0 Map	8	234.1	RGD
SHRSP x BN Map	8	27.82	UniSTS
FHH x ACI Map	8	28.0499	RGD
Cytogenetic Map	8	q21	UniSTS

D8Rat220

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	36,562,099 - 36,562,212 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	39,322,685 - 39,322,797	NCBI	Rnor6.0
Rnor_5.0	8	39,325,289 - 39,325,401	UniSTS	Rnor5.0
RGSC_v3.4	8	38,096,376 - 38,096,486	RGD	RGSC3.4
RGSC_v3.4	8	38,096,375 - 38,096,487	UniSTS	RGSC3.4
RGSC_v3.1	8	38,104,983 - 38,105,322	RGD
Celera	8	37,879,501 - 37,879,613	UniSTS
SHRSP x BN Map	8	27.75	UniSTS
SHRSP x BN Map	8	27.75	RGD
FHH x ACI Map	8	28.0499	RGD
Cytogenetic Map	8	q21	UniSTS

D8Rat218

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	8	38,096,366 - 38,096,488	UniSTS	RGSC3.4
RGSC_v3.1	8	38,105,131 - 38,105,254	RGD
Celera	8	37,879,500 - 37,879,622	UniSTS
RH 3.4 Map	8	311.3	UniSTS
SHRSP x BN Map	8	27.82	RGD

D8Got318

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	36,563,285 - 36,563,426 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	39,323,871 - 39,324,011	NCBI	Rnor6.0
Rnor_5.0	8	39,326,475 - 39,326,615	UniSTS	Rnor5.0
RGSC_v3.4	8	38,097,561 - 38,097,701	UniSTS	RGSC3.4
RGSC_v3.4	19	52,803,774 - 52,803,914	UniSTS	RGSC3.4
Celera	8	37,878,287 - 37,878,427	UniSTS
Cytogenetic Map	8	q21	UniSTS

D11S3963E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	36,589,509 - 36,589,617 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	39,350,097 - 39,350,204	NCBI	Rnor6.0
Rnor_5.0	8	39,353,139 - 39,353,246	UniSTS	Rnor5.0
RGSC_v3.4	8	38,123,810 - 38,123,917	UniSTS	RGSC3.4
Celera	8	37,852,042 - 37,852,149	UniSTS
Cytogenetic Map	8	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U48249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U63740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008285 ⟹ ENSRNOP00000008285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	36,544,535 - 36,589,683 (+)	Ensembl
Rnor_6.0 Ensembl	8	39,305,128 - 39,350,270 (+)	Ensembl

RefSeq Acc Id:

NM_031066 ⟹ NP_112328

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	44,733,385 - 44,778,519 (+)	NCBI
mRatBN7.2	8	36,544,535 - 36,589,683 (+)	NCBI
Rnor_6.0	8	39,305,128 - 39,350,270 (+)	NCBI
Rnor_5.0	8	39,307,579 - 39,353,313 (+)	NCBI
RGSC_v3.4	8	38,078,328 - 38,123,983 (+)	RGD
Celera	8	37,851,976 - 37,897,230 (-)	RGD

Sequence:

show sequence

TAGCTGGCTTGCCCGCTGCCGTTGCACTGCACCGGGCCACCTCTAGCCGGTGGATGGGGATGTC
TGGCTGAACCCCGGGATCCGATTCCCTCCTCCAGGACCTGCTCAGGGAAACGGATCTTGACAGT
TGCCATCATTGTACTACGGTGCCAGGATGGAGGCTCCACTGGTGAGTCTGGATGAAGAGTTTGA
AGATATCAGGCCCTGCTGCACTGAGGACCCAGAGGAAAAGCCACAAAGTCTCTATGGCACATCT
CCTCACCACCTGGAGGACCCTTCCCTCTCCGAGCTTGAGAATTTTTCTTCCGAAATAATCAGCT
TCAAGTCCATGGAGGACCTCGTGAATGAATTTGATGAGAAGCTCAATGTCTGCTTTCGGAACTA
CAATGCCAAGACCGAGAACCTGGCTCCAGTGAAGAACCAGTTGCAGATCCAGGAGGAGGAGGAG
ACTCTTCGGGATGAGGAGGTTTGGGATGCTCTGACAGACAATTACATCCCTTCACTCTCAGAAG
ACTGGAGGGACCCAAACATTGAAGCTCTGAATGGCAACAGCTCTGACACTGAGATCCACGAGAA
GGAAGAAGAAGATGAGTTCATTGAGAAGAGTGAAAACGACTCTGGTATCAACGAGGAGCCTCTC
CTCACAGCTGACCAGGTGATTGAGGAGATCGAAGAAATGATGCAGAACTCCCCAGATCCTGAGG
AGGAAGTGGAGGTGCTGGAAGAGGAGGATGGAGGAGAAATCTCGTCTCAGGCAGATTCAGTCCT
GCTACAAGAGATGCAGGCCCTGACGCAGACCTTCAACAACAACTGGTCCTATGAAGGGCTGAGA
CACATGTCTGGGTCTGAGCTGACAGAGCTGCTGGACCAGGTGGAGGGTGCCATCCGTGACTTCT
CGGAGGAGCTGGTCCACCAGCTGGCCCGCAGAGATGAGCTGGAGTTTGAGAAGGAAGTGAAGAA
CTCTTTCATCACGGTGCTCATTGAGGTTCAGAATAAGCAGAAGGAGCAGCGGGAACTGATGAAG
AAGAGGCGGAAAGAGAAGGGGTTAAGCCTGCAGAGCAGTCGGATAGAGAAGGGGAACCAGATGC
CTCTCAAGCGTTTCAGCATGGAGGGCATCTCCAACATCCTGCAGAGTGGCATCCGCCAGACCTT
TGGCTCCTCAGGAGCTGACAGACAGTACCTGAACACAGTCATCCCTTATGAGAAGAAATCTTCT
CCTCCCTCTGTGGAAGACCTGCAGATGCTGACAAACATTCTCTTCGCCATGAAGGAGGATAACG
AGAAGGTGCCTACTTTGCTAACGGACTACATTTTAAAAGTGCTCTGTCCAACCTAACCTCACCT
TTGGAGCAGCCTCACTGCAGGAGGTCACTGAGCAAGAAAGTCATTCCATCACTGGGATTGCATG
ACACCACGTAACCTCCGGCGTGTATTTAAACGTGTATAGCTTAACCTGGATTAAACATGAGCAA
CCGCGCACGCGCGGGGTCCTTTGCTGTTGGCTTCTAGTGCTAGTAATCATTGGATGCATGATCG
GGCGTAGGGCCAGTGACTCTGCTCCCTCTAACCTGTGTTGGGGAAGACAGGTGCCCTCACCACT
CATTATGTAGTCTGGCTCCAGCCCTCAACCCAGCTTATACTCTTCAGACTAATTTTGAAATAAA
CCTTCATTTAATTAATATCAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082202 ⟹ XP_038938130

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	44,733,313 - 44,778,517 (+)	NCBI
mRatBN7.2	8	36,544,462 - 36,589,684 (+)	NCBI

RefSeq Acc Id:

XM_063266208 ⟹ XP_063122278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	44,733,288 - 44,770,584 (+)	NCBI

RefSeq Acc Id:

XM_063266209 ⟹ XP_063122279

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	44,733,310 - 44,770,584 (+)	NCBI

RefSeq Acc Id:

XM_063266210 ⟹ XP_063122280

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	44,733,309 - 44,770,584 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112328	(Get FASTA)	NCBI Sequence Viewer
	XP_038938130	(Get FASTA)	NCBI Sequence Viewer
	XP_063122278	(Get FASTA)	NCBI Sequence Viewer
	XP_063122279	(Get FASTA)	NCBI Sequence Viewer
	XP_063122280	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB40630	(Get FASTA)	NCBI Sequence Viewer
	AAC71216	(Get FASTA)	NCBI Sequence Viewer
	AAH87740	(Get FASTA)	NCBI Sequence Viewer
	EDL84051	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008285
	ENSRNOP00000008285.3
	ENSRNOP00000101366
GenBank Protein	P97577	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112328 ⟸ NM_031066

- UniProtKB:

Q62922 (UniProtKB/Swiss-Prot), P97577 (UniProtKB/Swiss-Prot), A6KRM5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPLVSLDEEFEDIRPCCTEDPEEKPQSLYGTSPHHLEDPSLSELENFSSEIISFKSMEDLVN
EFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLRDEEVWDALTDNYIPSLSEDWRDPNIEA
LNGNSSDTEIHEKEEEDEFIEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEVEVLEEE
DGGEISSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVHQLA
RRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEG
ISNILQSGIRQTFGSSGADRQYLNTVIPYEKKSSPPSVEDLQMLTNILFAMKEDNEKVPTLLTD
YILKVLCPT

hide sequence

Ensembl Acc Id:

ENSRNOP00000008285 ⟸ ENSRNOT00000008285

RefSeq Acc Id:	XP_038938130 ⟸ XM_039082202
- Peptide Label:	isoform X2
- UniProtKB:	P97577 (UniProtKB/Swiss-Prot), Q62922 (UniProtKB/Swiss-Prot), A6KRM5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122278 ⟸ XM_063266208
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063122280 ⟸ XM_063266210
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063122279 ⟸ XM_063266209
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97577-F1-model_v2	AlphaFold	P97577	1-393	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

Promoter ID:

Type:

single initiation site

Name:

Fez1_1

Description:

fasciculation and elongation protein zeta 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	39,305,084 - 39,305,144	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619708	AgrOrtholog
BioCyc Gene	G2FUF-31100	BioCyc
Ensembl Genes	ENSRNOG00000006075	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008285	ENTREZGENE
	ENSRNOT00000008285.4	UniProtKB/Swiss-Prot
	ENSRNOT00000129566	ENTREZGENE
IMAGE_CLONE	IMAGE:7314065	IMAGE-MGC_LOAD
InterPro	FEZ	UniProtKB/Swiss-Prot
KEGG Report	rno:81730	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105385	IMAGE-MGC_LOAD
NCBI Gene	81730	ENTREZGENE
PANTHER	PTHR12394	UniProtKB/Swiss-Prot
	PTHR12394:SF4	UniProtKB/Swiss-Prot
Pfam	FEZ	UniProtKB/Swiss-Prot
PharmGKB	FEZ1	RGD
PhenoGen	Fez1	PhenoGen
RatGTEx	ENSRNOG00000006075	RatGTEx
UniProt	A6KRM5	ENTREZGENE, UniProtKB/TrEMBL
	FEZ1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q62922	ENTREZGENE
UniProt Secondary	Q62922	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-19	Fez1	fasciculation and elongation protein zeta 1	Fez1	fasciculation and elongation protein zeta 1 (zygin I)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fez1	fasciculation and elongation protein zeta 1 (zygin I)		protein kinase C-binding protein Zeta1	Name updated	1299863	APPROVED
2002-08-07	Fez1	protein kinase C-binding protein Zeta1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	protein present mainly in plasma membrane	728650
gene_expression	mRNA expressed in brain in embryo and adult	728650
gene_physical_interaction	interacts with N-terminal region (V1) of PKCzeta, and weakly with PKCepsilon	728650
gene_protein	contains 393 aa residues	728650